spacer

EBI Dbfetch

ID   BC093019; SV 1; linear; mRNA; STD; HUM; 1564 BP.
XX
AC   BC093019;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation
DE   protein, theta polypeptide, mRNA (cDNA clone MGC:110899 IMAGE:30520472),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1564
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1564
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0d39de060d86c9f40ab6bff003f21c75.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Stefan Hansson
CC   cDNA Library Preparation: Michael Brownstein /  Ted Usdin
CC   Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 198 Row: l Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21464103.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1564
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_147"
FT                   /clone="MGC:110899 IMAGE:30520472"
FT                   /tissue_type="Placenta, normal"
FT                   /note="Vector: pBluescriptR"
FT                   /db_xref="taxon:9606"
FT   gene            1..1564
FT                   /gene="YWHAQ"
FT                   /note="synonyms: HS1, 1C5"
FT   CDS             140..877
FT                   /codon_start=1
FT                   /gene="YWHAQ"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, theta polypeptide"
FT                   /db_xref="GOA:P27348"
FT                   /db_xref="H-InvDB:HIT000334510.10"
FT                   /db_xref="HGNC:HGNC:12854"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="PDB:2BTP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27348"
FT                   /protein_id="AAH93019.1"
FT                   /translation="MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLS
FT                   VAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
FT                   LIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPT
FT                   HPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLR
FT                   DNLTLWTSDSAGEECDAAEGAEN"
FT   misc_difference 1549..1564
FT                   /gene="YWHAQ"
FT                   /note="polyA tail: 16 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1564 BP; 434 A; 374 C; 347 G; 409 T; 0 other;
     aaagccaaaa gcagatcaaa gtggtgggac tcgcgtcgcg gccgcggaga cgtgaagctc        60
     tcgaggctcc tcccgctgcg ggtcggcgct cgccctcgct ctcctcgccc tccgccccgg       120
     ccccggcccc gcgcccgcca tggagaagac tgagctgatc cagaaggcca agctggccga       180
     gcaggccgag cgctacgacg acatggccac ctgcatgaag gcagtgaccg agcagggcgc       240
     cgagctgtcc aacgaggagc gcaacctgct ctccgtggcc tacaagaacg tggtcggggg       300
     ccgcaggtcc gcctggaggg tcatctctag catcgagcag aagaccgaca cctccgacaa       360
     gaagttgcag ctgattaagg actatcggga gaaagtggag tccgagctga gatccatctg       420
     caccacggtg ctggaattgt tggataaata tttaatagcc aatgcaacta atccagagag       480
     taaggtcttc tatctgaaaa tgaagggtga ttacttccgg taccttgctg aagttgcgtg       540
     tggtgatgat cgaaaacaaa cgatagataa ttcccaagga gcttaccaag aggcatttga       600
     tataagcaag aaagagatgc aacccacaca cccaatccgc ctggggcttg ctcttaactt       660
     ttctgtattt tactatgaga ttcttaataa cccagagctt gcctgcacgc tggctaaaac       720
     ggcttttgat gaggccattg ctgaacttga tacactgaat gaagactcat acaaagacag       780
     caccctcatc atgcagttgc ttagagacaa cctaacactt tggacatcag acagtgcagg       840
     agaagaatgt gatgcggcag aaggggctga aaactaaatc catacagggt gtcatccttc       900
     tttccttcaa gaaacctttt tacacatctc cattccttat tccacttgga tttcctatag       960
     caaagaaacc cattcatgtg tatggaatca actgtttata gtcttttcac actgcagctt      1020
     tgggaaaact tcattccttg atttgtgttt gtcttggcct tcctggtgtg cagtactgct      1080
     gtagaaaagt attaatagct tcatttcata taaacataag taactcccaa acacttatgt      1140
     agaggactaa aaatgtatct ggtatttaag taatctgaac cagttctgca agtgactgtg      1200
     ttttgtatta ctgtgaaaat aagaaaatgt agttaattac aatttaaaga gtattccaca      1260
     taacttctta atttctacat tccctccctt actcttcggg ggtttccttt cagtaagcaa      1320
     cttttccatg ctcttaatgt attccttttt agtaggaatc cggaagtatt agattgaatg      1380
     gaaaagcact tgccatctct gtctaggggt cacaaattga aatggctcct gtatcacata      1440
     cggaggtctt gtgtatctgt ggcaacaggg agtttcctta ttcactcttt atttgctgct      1500
     gtttaagttg ccaacctccc ctcccaataa aaattcactt acacctccaa aaaaaaaaaa      1560
     aaaa                                                                   1564
//


spacer
spacer