spacer

EBI Dbfetch

ID   BC092378; SV 1; linear; mRNA; STD; MUS; 1292 BP.
XX
AC   BC092378;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus nucleophosmin 1, mRNA (cDNA clone MGC:106684 IMAGE:5710278),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1292
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1292
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-APR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ab8a7d0d0a1c56fcd039ad0bee1dff01.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 205 Row: b Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6679107.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1292
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_ER0"
FT                   /clone="MGC:106684 IMAGE:5710278"
FT                   /tissue_type="Brain, mouse 15 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1292
FT                   /gene="Npm1"
FT                   /note="synonyms: B23, NO38"
FT   CDS             63..941
FT                   /codon_start=1
FT                   /gene="Npm1"
FT                   /product="nucleophosmin 1"
FT                   /db_xref="GOA:Q5SQB7"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQB7"
FT                   /protein_id="AAH92378.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
FT   misc_difference 1246..1292
FT                   /gene="Npm1"
FT                   /note="polyA tail: 47 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1292 BP; 467 A; 210 C; 300 G; 315 T; 0 other;
     ggaacaggag gcagttgttt tccgtccggc ttctcccaca ccgaagtgcg cgcctccacc        60
     tcatggaaga ctcgatggat atggacatga gtcctcttag gcctcagaac taccttttcg       120
     gctgtgaact aaaggctgac aaagactatc actttaaagt ggataatgat gaaaatgagc       180
     accagttgtc attaagaacg gtcagtttag gagcaggggc aaaagatgag ttacacatcg       240
     tagaggcaga agcaatgaac tatgaaggca gtccaattaa agtaacactg gcaactttga       300
     aaatgtctgt acaaccaaca gtttccctag ggggctttga aattacacca cctgtggtct       360
     tacggttgaa gtgtggttca gggcctgtgc acattagtgg acagcatcta gtagctgtag       420
     aggaagatgc agagtctgaa gatgaagatg aggaggacgt aaaactctta ggcatgtctg       480
     gaaagcgatc tgctcctgga ggtggtaaca aggttccaca gaaaaaagta aaacttgatg       540
     aagatgatga ggacgatgat gaggacgatg aggatgatga ggatgatgat gatgatgatt       600
     ttgatgaaga ggaaactgaa gaaaaggtcc cagtgaagaa atctgtacga gataccccag       660
     ccaaaaatgc acaaaaatca aaccaaaatg gaaaagactt aaaaccatca acaccgagat       720
     caaagggtca agagtccttc aaaaaacagg aaaagactcc taaaacacca aaaggaccta       780
     gttctgtaga agacattaag gcaaaaatgc aagcaagtat agaaaaaggc ggttctcttc       840
     ccaaagtgga agccaagttc attaattatg tgaagaattg tttccggatg actgaccagg       900
     aggctattca agatctctgg cagtggagga aatctcttta agaaaagggt ttaaacagtt       960
     tgaaatattc tgtcttcatt tctgtaatag ttaatatctg gctgtccttt ttataatgca      1020
     aagtgagaac tttccctact gtgtttgata aatgttgtcc aggttcactt gccaagaatg      1080
     tgttgtctaa aatgcctgtt tagttttcaa ggatggaact ccacccttta cttggtttta      1140
     agtatgtatg gaatgttatg ataggacata gtaatagtgg tcagatgtgg aaatggtagg      1200
     gagacaaata tacatgtgaa ataaactcag tattttaata aagtaaaaaa aaaaaaaaaa      1260
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa                                    1292
//


spacer
spacer