Dbfetch

ID   BC092046; SV 1; linear; mRNA; STD; MUS; 2335 BP.
XX
AC   BC092046;
XX
DT   31-MAR-2005 (Rel. 83, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus transferrin, mRNA (cDNA clone MGC:102653 IMAGE:3594705),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2335
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2335
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-MAR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3cb0e0a595ef7827af251d3c088243ae.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035196; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035176; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035108; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035169; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034879; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035689; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034191; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034848; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035009; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034957; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035085; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034996; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035711; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034311; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093929; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094013; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093966; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093939; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093516; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094453; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094114; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093645; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093499; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093653; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093475; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094780; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092513; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 193 Row: c Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 20330801.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2335
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:102653 IMAGE:3594705"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2335
FT                   /gene="Trf"
FT                   /note="synonyms: Tfn, Cd176, HP"
FT   CDS             32..2125
FT                   /codon_start=1
FT                   /gene="Trf"
FT                   /product="transferrin"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="InterPro:IPR030685"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="AAH92046.1"
FT                   /translation="MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKH"
FT   misc_difference 142
FT                   /gene="Trf"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 640
FT                   /gene="Trf"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1957
FT                   /gene="Trf"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2219
FT                   /gene="Trf"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2294..2335
FT                   /gene="Trf"
FT                   /note="polyA tail: 42 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2335 BP; 614 A; 581 C; 622 G; 518 T; 0 other;
     ccccgctcct cgccacacac acaccgagag gatgaggctc accgtgggtg ccctgctggc        60
     ctgcgctgcc ctggggctgt gtctggctgt ccctgacaaa acggtcaaat ggtgcgcagt       120
     gtcagagcac gagaatacca aatgcatcag cttccgtgac cacatgaaga ccgtccttcc       180
     gcctgatggc ccccggcttg cctgtgtgaa gaaaacctcc tatccggatt gcatcaaggc       240
     catttctgca agtgaagccg atgctatgac cttggatggg ggttgggtgt acgatgccgg       300
     cctgactccg aacaacctga agcccgtggc ggcggagttt tatggatcag tggaacatcc       360
     acagacctac tactacgctg tggctgtggt aaagaaggga acagacttcc agctgaacca       420
     gctcgaaggc aagaagtcct gccacacagg cctgggaagg tctgcaggct gggtcatccc       480
     cattggcttg ctcttctgta agctgtcgga gccccgcagt cctcttgaga aagctgtgtc       540
     cagtttcttc tcgggcagtt gtgtcccctg tgcagatcca gtggccttcc ccaaactgtg       600
     tcaactgtgc ccaggctgtg gctgctcctc cactcaaccg ttctttggct acgtaggcgc       660
     attcaagtgt ctgaaagatg gcggtgggga tgtggccttt gtcaagcaca caaccatatt       720
     tgaggtcttg ccggagaagg ctgacaggga ccaatatgaa ctgctctgcc ttgacaatac       780
     ccgcaagcca gtggatcagt atgaggattg ctacctggct cggatccctt ctcatgctgt       840
     tgtggctcga aaaaacaatg gcaaggaaga cttgatctgg gagattctca aagtggcaca       900
     ggaacacttt ggcaaaggca aatcaaaaga cttccaactg ttcagctctc ctcttgggaa       960
     agacctgctg tttaaagatt ctgcctttgg gctgttaagg gtccccccaa ggatggacta      1020
     caggctgtac cttggccata actatgtcac tgccattcgg aatcagcagg aaggcgtgtg      1080
     cccggagggc tcgatcgaca actcgccagt gaagtggtgt gcactgagtc acctggagag      1140
     aaccaagtgt gacgagtgga gcatcatcag tgagggaaag atagagtgtg agtcagcaga      1200
     gaccactgag gactgcattg aaaagattgt gaacggagaa gcggacgcca tgactttgga      1260
     tggaggacat gcctacattg caggccagtg tggtctagtg cctgtcatgg cagagtacta      1320
     cgagagctct aattgtgcca tcccatcaca acaaggtatc tttcctaaag ggtattatgc      1380
     cgtggctgtg gtgaaggcat cggacactag catcacctgg aacaacctga aaggcaagaa      1440
     gtcctgccac actggggtag acagaaccgc tggttggaac atccctatgg gcatgctgta      1500
     caacaggatc aaccactgca aattcgatga atttttcagt caaggctgcg ctcccgggta      1560
     tgagaagaat tccaccctct gtgacctgtg tattggccca ctcaaatgtg ctccgaacaa      1620
     caaagaggaa tataatggtt acacaggggc tttcaggtgt ctcgttgaga aaggagatgt      1680
     agcctttgtg aaacaccaga ctgtcctgga taacaccgaa ggaaagaacc ctgccgaatg      1740
     ggctaagaat ctgaagcagg aagacttcga gttgctctgc cctgatggca ccaggaagcc      1800
     tgtgaaagat tttgccagct gccacctggc ccaagctcca aaccatgttg tggtctcacg      1860
     aaaagagaag gcagcccggg ttaaggctgt actgactagc caggagactt tatttggggg      1920
     aagtgactgc accggcaatt tctgtttgtt caagtctacc accaaggacc ttctgttcag      1980
     ggatgacacc aaatgtttcg ttaaacttcc agagggtacc acacctgaaa aatacttagg      2040
     agcggagtac atgcaatctg tcggtaacat gaggaagtgc tcaacctcac gactcctgga      2100
     agcctgcact ttccacaaac attaaaatcc aagaggtggg ttgccactgt ggtggagaca      2160
     gatgctccct cccgtggccc atgggcttct cttggtcttc atgccctgag gggttgggac      2220
     taactggtgt agtcttcgct gctgtgcctt accacataca cagagcacaa aataaaaacg      2280
     actgctgact ttaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa           2335
//