spacer

EBI Dbfetch

ID   BC089546; SV 1; linear; mRNA; STD; MUS; 1312 BP.
XX
AC   BC089546;
XX
DT   03-FEB-2005 (Rel. 82, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus nucleophosmin 1, mRNA (cDNA clone MGC:107291 IMAGE:30505980),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1312
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1312
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-FEB-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e8a3662ea386cdced4c60e127c4d046c.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Yoshihiko Yamada,  NIDCR,
CC   acknowledge-Dr.Takashi Nakamura, NIDCR
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 63 Row: k Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6679107.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1312
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_190"
FT                   /clone="MGC:107291 IMAGE:30505980"
FT                   /tissue_type="Molar, pooled, newborn mouse, strain ICR.
FT                   First molars, tooth, including ameloblasts and
FT                   odontoblast."
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10090"
FT   gene            1..1312
FT                   /gene="Npm1"
FT                   /note="synonyms: B23, NO38"
FT   CDS             98..976
FT                   /codon_start=1
FT                   /gene="Npm1"
FT                   /product="nucleophosmin 1"
FT                   /db_xref="GOA:Q5SQB7"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQB7"
FT                   /protein_id="AAH89546.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
FT   misc_difference 364
FT                   /gene="Npm1"
FT                   /note="'T' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 601
FT                   /gene="Npm1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1217..1219
FT                   /gene="Npm1"
FT                   /note="3 bases in cDNA are not found in the mouse genome."
FT   misc_difference 1282..1312
FT                   /gene="Npm1"
FT                   /note="polyA tail: 31 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1312 BP; 449 A; 221 C; 312 G; 330 T; 0 other;
     ccttggcgtg attccgtcct gcgcgtctgt tctgtggaac aggaggcagt tgttttccgt        60
     ccggcttctc ccacaccgaa gtgcgcgcct ccacctcatg gaagactcga tggatatgga       120
     catgagtcct cttaggcctc agaactacct tttcggctgt gaactaaagg ctgacaaaga       180
     ctatcacttt aaagtggata atgatgaaaa tgagcaccag ttgtcattaa gaacggtcag       240
     tttaggagca ggggcaaaag atgagttaca catcgtagag gcagaagcaa tgaactatga       300
     aggcagtcca attaaagtaa cactggcaac tttgaaaatg tctgtacaac caacagtttc       360
     ccttgggggc tttgaaatta caccacctgt ggtcttacgg ttgaagtgtg gttcagggcc       420
     tgtgcacatt agtggacagc atctagtagc tgtagaggaa gatgcagagt ctgaagatga       480
     agatgaggag gacgtaaaac tcttaggcat gtctggaaag cgatctgctc ctggaggtgg       540
     taacaaggtt ccacagaaaa aagtaaaact tgatgaagat gatgaggacg atgatgagga       600
     tgatgaggat gatgaggatg atgatgatga tgattttgat gaagaggaaa ctgaagaaaa       660
     ggtcccagtg aagaaatctg tacgagatac cccagccaaa aatgcacaaa aatcaaacca       720
     aaatggaaaa gacttaaaac catcaacacc gagatcaaag ggtcaagagt ccttcaaaaa       780
     acaggaaaag actcctaaaa caccaaaagg acctagttct gtagaagaca ttaaggcaaa       840
     aatgcaagca agtatagaaa aaggcggttc tcttcccaaa gtggaagcca agttcattaa       900
     ttatgtgaag aattgtttcc ggatgactga ccaggaggct attcaagatc tctggcagtg       960
     gaggaaatct ctttaagaaa agggtttaaa cagtttgaaa tattctgtct tcatttctgt      1020
     aatagttaat atctggctgt cctttttata atgcaaagtg agaactttcc ctactgtgtt      1080
     tgataaatgt tgtccaggtt cacttgccaa gaatgtgttg tctaaaatgc ctgtttagtt      1140
     ttcaaggatg gaactccacc ctttacttgg ttttaagtat gtatggaatg ttatgatagg      1200
     acatagtaat agtggtggtc agatgtggaa atggtaggga gacaaatata catgtgaaat      1260
     aaactcagta ttttaataaa gcaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa              1312
//


spacer
spacer