spacer

EBI Dbfetch

ID   BC089164; SV 1; linear; mRNA; STD; MUS; 4644 BP.
XX
AC   BC089164;
XX
DT   27-JAN-2005 (Rel. 82, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus protein kinase D3, mRNA (cDNA clone MGC:99952 IMAGE:5400250),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4644
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4644
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (21-JAN-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8f031a1157c323011ca804655abe7c85.
DR   Ensembl-Gn; ENSMUSG00000024070; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119284; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 177 Row: p Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 27753988.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4644
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:99952 IMAGE:5400250"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4644
FT                   /gene="Prkd3"
FT                   /note="synonym: PKD3"
FT   CDS             662..3334
FT                   /codon_start=1
FT                   /gene="Prkd3"
FT                   /product="protein kinase D3"
FT                   /db_xref="GOA:Q5FWX6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015727"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="MGI:MGI:1922542"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FWX6"
FT                   /protein_id="AAH89164.1"
FT                   /translation="MSANNSPPSAQKSVFPATVSAVLPAPSPCSSPKTGLSARLSNGSF
FT                   SAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFG
FT                   MYDKILLFRHDMNSENILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHALYVHSYK
FT                   APTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGL
FT                   SVPRPLQPECVPLLSEESHTHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGR
FT                   PTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPCSVGTDADM
FT                   PMDIDSSDVNSDGSRGLDDSEEPSPPEDKMFFLDPTDLDVERDEETVKTISPSTSNNIP
FT                   LMRVVQSIKHTKRRSSTVVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYK
FT                   EIPLSEILRVSSPQDFTSISQGSNPHCFEIITDTVVYFVGENNGSSSHNPVLAATGVGL
FT                   DVAQSWEKAIRQALMPVTPQASVCTSPGQGKDHKDLATSISVSNCQVQENVDISSVYQI
FT                   FADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGI
FT                   VNLECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKN
FT                   IVHCDLKPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGY
FT                   NRSLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNAAFMYPPNPWREISSEAIDLINNL
FT                   LQVKMRKRYSVDKSLSHPWLQDYQTWLDLREFETRIGERYITHESDDARWEIHAYTHNL
FT                   EYPKHFIMAPNPDDMEEDP"
FT   misc_difference 4643..4644
FT                   /gene="Prkd3"
FT                   /note="2 bases at the 3' end do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4644 BP; 1316 A; 1022 C; 1047 G; 1259 T; 0 other;
     gactttctcc agaacagccg agcccgcctc tgttgacagc atttcagaag gcaccagctt        60
     ttctctctgg atccattcat ccaaagaaat atgtttgtac tatttttaca agctttttat       120
     ttttacttca tcacagggaa gttcagtccc aagatggaaa tgagttccta tgagagggta       180
     aactaaggtg tgaccatttg tggtgtcccg tcaatccctg aaggcataga ttatctgaaa       240
     ctacttttaa tcaggaagat ttcatatctt gatacagatc aactattctg tttgtttttc       300
     tgaaatgaaa agcaaaagac aagagcagat ttagaagaag tgaagatgtc ttgtaaatat       360
     tcagcatgaa ctctgttctt ccgacgatga tggtgatgtg aagtggggga cagatctggg       420
     tgtggtccta aagacaagat tcttgatggg actgataccg acagcaatag gatcttttga       480
     gtattcaact cggagtaaca gaatttgtca tcaacggcat gaatggctca gccgaggaaa       540
     tagagcagct ttcatctaaa tccaagcgtg tcgtcatttt ttcactgcta ttattttgaa       600
     aacttcttca aaaccattta aaaagcattg acaactaatt ttatagatca aagaaaggca       660
     gatgtctgca aataattccc ctccatcagc ccagaaatct gtgttccctg caactgtttc       720
     tgctgtgctt ccagctcctt ctccgtgttc aagtcccaaa acaggactct cagctcggct       780
     ctctaatggc agcttcagtg ccccgtcact cacaaactct agaggctcag tgcacacagt       840
     ttcatttcta cttcagattg gcctcacacg agagagtgtt accatcgagg cccaggaact       900
     gtctctctct gctgtcaaag acctcgtgtg ctccattgtt tatcagaagt ttccagagtg       960
     tggattcttt ggcatgtatg ataaaattct tctctttcgc cacgacatga actcagaaaa      1020
     cattttgcag ctgattacct cagcagatga aatacatgaa ggggacctgg tagaagttgt      1080
     cctgtcagct ttggccacag tggaagactt ccagatccgc cctcacgctc tctatgtaca      1140
     ttcttacaaa gcacctactt tttgtgatta ctgtggtgaa atgctctggg gactggtacg      1200
     tcaaggatta aaatgtgaag gctgtggatt aaattatcat aaacgatgtg ccttcaagat      1260
     tccaaataac tgcagtggag taagaaagag acgtctgtca aatgtatctc tgccaggacc      1320
     tggcctctca gttccaagac ccctgcagcc tgagtgtgtg ccccttctca gtgaagagtc      1380
     acatactcac caagagccca gtaagagaat cccgtcgtgg agtggtcgtc cgatctggat      1440
     ggaaaagatg gtaatgtgca gggtcaaagt ccctcacaca tttgctgtcc actcttatgg      1500
     ccgcccgacc atatgccagt actgcaagcg cctgctgaaa ggcctcttcc gccaagggat      1560
     gcagtgtaaa gattgcaaat tcaactgcca taaacgctgt gcatccaaag taccaagaga      1620
     ctgccttggc gaagttactt tcaatggaga gccgtgcagc gtggggactg atgcagacat      1680
     gcccatggat attgacagta gtgatgtgaa cagtgatggc agtaggggct tggatgactc      1740
     agaggagccg tccccgcccg aagacaagat gttcttcctc gacccgactg atctcgacgt      1800
     ggagcgagat gaggagactg ttaagacaat cagtccatcc accagcaata atatcccgct      1860
     gatgagggtg gtgcagtcca tcaagcacac aaagaggagg agcagcacag ttgtgaagga      1920
     agggtggatg gtccactaca ccagcaggga caacctgaga aagagacatt attggagact      1980
     tgacagtaaa tgtctaacat tgtttcaaaa tgaatctgga tcaaagtatt ataaggaaat      2040
     tccactttca gaaattctcc gtgtatcttc accgcaagat ttcaccagca tttcacaagg      2100
     cagtaaccca cactgttttg aaatcatcac cgataccgtg gtatactttg ttggtgagaa      2160
     caatgggagc agctctcata atcctgttct cgctgccact ggagtgggac tagatgtggc      2220
     gcagagctgg gaaaaagcaa ttcgccaggc cctcatgcct gtcactcctc aagcaagtgt      2280
     ttgcacttct ccggggcaag ggaaggacca caaagatctg gctaccagta tctccgtgtc      2340
     taactgtcag gttcaggaga atgtcgacat cagcagcgtt taccagatct ttgcggacga      2400
     ggtgcttggt tctggccagt ttggcattgt ttatggagga aaacacagaa agacgggaag      2460
     ggatgtggct attaaagtga ttgataaaat gaggttcccc acaaagcaag agagtcagct      2520
     ccggaacgaa gtggccattt tacagaatct gcaccatcct gggattgtaa acctggagtg      2580
     tatgtttgaa accccagaac gagtcttcgt ggtgatggaa aagctccatg gagatatgtt      2640
     ggaaatgatt ctgtccagtg aaaagagtcg acttccagaa cggattacca aattcatggt      2700
     cacacagata cttgttgcct tgaggaattt acatttcaag aatattgtgc actgtgattt      2760
     aaagcccgaa aatgtgctgc ttgcatccgc agagccattt cctcaggtga agctgtgtga      2820
     ctttgggttt gcccgcatca ttggtgagaa gtcgttccgg aggtcagtgg taggaactcc      2880
     agcctactta gcccctgagg ttctcaggag caaaggctac aaccgttctc tagacatgtg      2940
     gtcggtgggc gtcatcgttt atgtgagcct cagtggcaca ttcccattca atgaagatga      3000
     agatataaat gaccaaatcc aaaacgctgc gtttatgtac ccaccaaatc catggcgaga      3060
     aatttccagt gaagcaattg acttgataaa caacttgctt caagtgaaga tgagaaaacg      3120
     atacagtgtt gacaaatctc tcagtcatcc ttggctacag gattatcaga cttggcttga      3180
     cctcagagaa tttgaaactc gcattggaga acgttacatt acacacgaaa gtgatgatgc      3240
     tcgctgggaa atacacgcat acacgcacaa tctggaatac ccaaagcatt tcattatggc      3300
     ccccaaccca gacgacatgg aggaggatcc ttagttgtca gtgcgccgac ctcaataagg      3360
     aaggatttca cttcaagagc ggatactttg ctgcatggct ggtggcctct gcaggctacc      3420
     attgcaaggc ggcagcaccg tgaggaagta gaaggacttg tggcatcagt tctgtagctc      3480
     ataacgagta ggtacatgaa gggaaactga gtaataaagt caaaatggaa cttctataaa      3540
     tttttatagc ataagcaata actggttctg taatttttcc taatccttca cattagcaca      3600
     atgtgagtta gcacttaatt tatctctttt acctctcctt ttctgttatt acatcatttg      3660
     ttttaaaggc ctatgactgt ctagttattg cttataaggt tgattactca acaggtttgc      3720
     agttaagcag taaccatgag gctaacagca tacagcttgc tgtaaggacc tttagtgttt      3780
     gtccactgtc ggaggcattg cttcctcctt cctggacccg ataagcagac cattgtactg      3840
     ctggccttcc ggtggatgcg tctttccata tggcctgtat gacagaagag ttgtcacatt      3900
     ttccatgtta taacagtcac taggataatc gaacaattgg tgttacaaat gaatagaaat      3960
     agctggtcat cactcagctc tgcctctgaa cacgtatgtt ctcaattggc accatcatgt      4020
     tacagtatgc cacagtcggt gggcacaacg ctgcatttaa ctaatttatc ctcacctgga      4080
     gttgaataat gtatagacaa aatcacatac tagagaggga agctaacaca ggtcagtaga      4140
     tgtcactgtt atctgtttcc tcttcccttg gcctttggat ggggtttcca atacctagtg      4200
     tttttaaatt agcattgtcg tttgagcagt ttggaggagt gactgaagtc aaacatgaaa      4260
     acttagttta ttgaggtggg acctaattac cagtagagcg gatggagaag gagtaagaac      4320
     gtcttacact tcagctccaa cagccagctg ttttgtagta gttattaata caaggtcagt      4380
     atccctatct gagctgctct acaccaggaa ggtttcactg ccagatactg aaatgtttgc      4440
     acactctact agttgagcat ccctgaccta caaatccgaa atcctccaaa ttcaagaaac      4500
     tttggagtcc ttcagatttc cacattagtg atattcccac ctgtgcttta cccaaagaga      4560
     aaaagatcca ggaccatcct ctcacaagaa atatagtagc tgtttgtttc ttcattcctc      4620
     actagtcaca aaaaaaaaaa aaaa                                             4644
//


spacer
spacer