Dbfetch

ID   BC089034; SV 1; linear; mRNA; STD; MUS; 997 BP.
XX
AC   BC089034;
XX
DT   10-AUG-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus prohibitin, mRNA (cDNA clone MGC:115794 IMAGE:30675988),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-997
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-997
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JAN-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 94546cbe82fc86cd92e5cd575407b274.
DR   Ensembl-Gn; ENSMUSG00000038845; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018986; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018954; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018924; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018927; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018741; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019379; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018295; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018712; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018820; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018809; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018890; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018836; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019419; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018066; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018344; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000125172; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031841; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0031786; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0031771; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031775; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031572; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032295; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031356; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0031487; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0031626; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0031618; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0031746; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031601; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032314; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031072; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031051; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..997
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_HV0"
FT                   /clone="MGC:115794 IMAGE:30675988"
FT                   /tissue_type="Eye"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..997
FT                   /gene="Phb"
FT                   /note="synonym: BAP32"
FT   CDS             38..856
FT                   /codon_start=1
FT                   /gene="Phb"
FT                   /product="prohibitin"
FT                   /db_xref="GOA:P67778"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:97572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67778"
FT                   /protein_id="AAH89034.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   misc_difference 979..997
FT                   /gene="Phb"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 997 BP; 251 A; 259 C; 281 G; 206 T; 0 other;
     gtgaaagcag gtgtgagtgg aagcaacaga aggagtcatg gctgccaaag tgtttgagtc        60
     cattggaaag ttcggcctgg cgttggcagt tgcaggaggc gtggtgaact ctgctttgta       120
     taatgtggat gctggacaca gagctgtcat ctttgaccga ttccgtggcg tacaggacat       180
     tgtggtcggg gaagggactc atttcctcat cccttgggta cagaaaccaa ttatctttga       240
     ctgccgctct cgaccacgga acgtaccagt catcactggt agcaaagact tgcagaacgt       300
     caatatcaca ctgcgaatcc tcttccggcc ggtggccagc cagcttcctc gtatctacac       360
     cagcattggc gaggactatg atgagcgggt cctgccttct atcaccacag agatcctcaa       420
     gtcggtggtg gctcgattcg atgctggaga attgattacc cagcgagagc tggtctccag       480
     gcaggtgagc gatgacctca cagagcgagc ggcaacattt gggcttatcc tggatgacgt       540
     gtccctgaca catctgacct tcgggaagga gttcacagag gcagtagaag ccaaacaggt       600
     ggctcagcag gaagcggaga gagccagatt tgtggtggaa aaggctgagc agcagaagaa       660
     ggcagccatc atctctgctg agggtgactc caaggccgct gagctgatcg ccaactcgct       720
     ggccacggca ggcgacggcc tgatcgagct gcggaagctg gaggccgccg aggacattgc       780
     gtaccagctc tcccgctctc ggaacatcac ctacctgcca gcgggccagt ccgtgcttct       840
     ccagcttccc cagtgaggcc agccgggcca cggcctccat catgctgaat gacgccttcc       900
     ttctgcccca ccccagaaaa tcactgtgaa atttcatgat tggcttaaag tgaaggaaat       960
     aaaggtaaaa tcacttcaaa aaaaaaaaaa aaaaaaa                                997
//