spacer

EBI Dbfetch

ID   BC087892; SV 1; linear; mRNA; STD; MUS; 1647 BP.
XX
AC   BC087892;
XX
DT   04-JAN-2005 (Rel. 82, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus tRNA aspartic acid methyltransferase 1, mRNA (cDNA clone
DE   MGC:107176 IMAGE:30504522), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1647
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1647
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (20-DEC-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8aefd5962c4a72154324315ec3810d40.
DR   Ensembl-Gn; ENSMUSG00000026723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124488; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Yoshihiko Yamada,  NIDCR,
CC   acknowledge-Dr.Takashi Nakamura, NIDCR
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 63 Row: k Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31560600.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1647
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_190"
FT                   /clone="MGC:107176 IMAGE:30504522"
FT                   /tissue_type="Molar, pooled, newborn mouse, strain ICR.
FT                   First molars, tooth, including ameloblasts and
FT                   odontoblast."
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10090"
FT   gene            1..1647
FT                   /gene="Trdmt1"
FT                   /note="synonym: Rnmt2"
FT   CDS             33..1280
FT                   /codon_start=1
FT                   /gene="Trdmt1"
FT                   /product="tRNA aspartic acid methyltransferase 1"
FT                   /db_xref="GOA:Q5I0V6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR025813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1274787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5I0V6"
FT                   /protein_id="AAH87892.1"
FT                   /translation="MEPLRVLELYSGIGGMHHALRESHIPAHVVAAIDVNTVANEVYKH
FT                   NFPHTHLLSKTIEGISLEDFDKLSFNMILMSPPCQPFTRIGLQGDMTDPRTTSFLYILD
FT                   ILPRLQKLPKYILLENVKGFEVSSTRGLLIQTIEACGFQYQEFLLSPSSLGIPNSRLRY
FT                   FLIAKLQSEPFPFQAPGQILMEFPKIVTVEPQKYAVVEESQPRVQRTGPRICAESSSTQ
FT                   SSGKDTILFKLETVEERDRKHQQDSDLSVQMLKDFLEDGDTDEYLLPPKLLLRYALLLD
FT                   IVKPTSRRSMCFTKGYGSYIEGTGSVLQAAEDAQIENIYKSLPDLPPEEKIAKLSMLKL
FT                   RYFTPKEIANLQGFPPEFGFPEKTTVKQRYRLLGNSLNVHVVAKLLTVLCEGFGNASES
FT                   CHKMPLILDSNSKILS"
FT   misc_difference 1518
FT                   /gene="Trdmt1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1618..1647
FT                   /gene="Trdmt1"
FT                   /note="polyA tail: 30 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1647 BP; 493 A; 349 C; 328 G; 477 T; 0 other;
     agtttccagg ccgcggtcgc ggttgcgaga ggatggaacc tctgcgtgtc ctggagctgt        60
     acagtggcat tggtggcatg caccacgcgc tgcgagaaag tcatatccct gcacatgtgg       120
     tggctgctat tgatgtgaat actgttgcta atgaagtata caagcataat tttcctcata       180
     ctcacttact gtcaaagaca attgaaggta tttcactgga agactttgac aagctatctt       240
     tcaatatgat tttaatgagc cctccatgcc agccattcac aagaattggc ctacaggggg       300
     atatgaccga tccaaggaca actagcttct tgtatattct agatattctc ccaagattac       360
     aaaaattacc caagtatatt ctcttagaaa atgtcaaagg ttttgaagta tcttctacaa       420
     gagggctgct gatacaaaca atagaagcct gtggctttca gtatcaagag tttctattgt       480
     ctccttcttc tctaggcatt ccaaactcga ggctccgata ttttctcatt gcaaagcttc       540
     agtcagagcc tttccccttc caggcccctg gacagatact gatggagttt cctaaaattg       600
     taactgttga gccacaaaaa tatgcagtag ttgaagaaag tcagccaaga gtgcagagaa       660
     ctggaccacg tatctgtgct gagagcagca gcacacagag ttctggaaaa gataccattc       720
     tctttaagct tgagactgta gaagaaaggg acaggaaaca tcaacaagac agtgacctct       780
     ctgtgcagat gctgaaagac ttccttgaag atggcgacac agatgagtac cttttaccac       840
     ccaagttatt gctgcgatac gctctcttac tagatatcgt gaagcccacg tccagaaggt       900
     ccatgtgctt tacgaaaggg tatgggagtt acatagaggg gacaggctcc gtgttacagg       960
     ctgcagagga tgcgcagatt gagaatatct acaaatctct tcctgatttg ccaccagaag      1020
     aaaagatagc taaattgtca atgcttaaac tgcgatattt cacaccgaaa gaaattgcaa      1080
     atctccaggg atttcctcca gaatttgggt ttcctgagaa gacaacagtg aaacagcgtt      1140
     accggctgct tggcaatagc ctcaacgtgc atgtggtagc aaaactcctc acagtcctgt      1200
     gtgaaggatt tggaaatgcc tctgagagct gtcacaagat gccgctaatt ctagatagta      1260
     attccaagat tctatcttga atgaattctt atagagttca gctaaattct ttgaatagca      1320
     ttttcctggg taattcagca ggaacttaaa tgtgtacatc caattgtccc tcacatttat      1380
     gtcactgtat catccaattg tccctcacat ttatgtcact gtatcatcca attgtccctc      1440
     acatttatgt cactgtatca tccaattgtc ccttacattt atgtcactgt atcatccaat      1500
     tgtcccttac atttatgcca ctggatttga taacttcaca ttgctggttt tgctttatgg      1560
     acaaatattt ttacaaagct tttaaacttg tgtattaaat atcttttata ttatgttgaa      1620
     aaaaaaaaaa aaaaaaaaaa aaaaaaa                                          1647
//


spacer
spacer