spacer

EBI Dbfetch

ID   BC085491; SV 1; linear; mRNA; STD; MUS; 2170 BP.
XX
AC   BC085491;
XX
DT   03-NOV-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus spinster homolog 1 (Drosophila), mRNA (cDNA clone MGC:102040
DE   IMAGE:6829415), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2170
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2170
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-NOV-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9d41d8cb540d90a6a5a1f945dbdc7aca.
DR   Ensembl-Gn; ENSMUSG00000030741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032994; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 195 Row: i Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 12963794.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2170
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FD0"
FT                   /clone="MGC:102040 IMAGE:6829415"
FT                   /tissue_type="Brain, mouse 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2170
FT                   /gene="Spns1"
FT                   /note="synonyms: Spin1, Spinl"
FT   CDS             302..1888
FT                   /codon_start=1
FT                   /gene="Spns1"
FT                   /product="spinster homolog 1 (Drosophila)"
FT                   /db_xref="GOA:Q8R0G7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1920908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R0G7"
FT                   /protein_id="AAH85491.1"
FT                   /translation="MAGSDTAPFLSQADDPDDGPAPGHPGLPGPMGNPKSGELEVPDCE
FT                   GLQRITGLSRGHSTLIVVVLCYINLLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVF
FT                   ISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPREHFWLLLLTRGLVGVG
FT                   EASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDVAGDWHWALRV
FT                   TPGLGVLAVLLLFLVVQEPPRGAVERHSGSPPLSPTSWWADLKALARNPSFVLSSLGFT
FT                   SVAFVTGSLALWAPAFLLRSRVVLGETPPCLPGDSCSSSDSLIFGLITCLTGVLGVGLG
FT                   VEISRRLRRFNPRADPLVCAAGLLGSAPFLFLALACARGSIVATYIFIFIGETLLSMNW
FT                   AIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRSWPPSFLSEFR
FT                   ALQFSLMLCAFVGALGGAAFLGTAMFIEDDRRRAQLHVQGLLHESGPSDDRIVVPQRGR
FT                   STRVPVSSVLI"
FT   misc_difference 2141..2170
FT                   /gene="Spns1"
FT                   /note="polyA tail: 30 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2170 BP; 386 A; 650 C; 627 G; 507 T; 0 other;
     cttggactga gcaacagcga gtgtggcgcg ctccttcccg ggctttggag tgcgtcagcg        60
     tgagaagagg gactgggtcc tggtcttcct gctcctgtcc cagcgtcacc tgcacctcct       120
     gtgtgctctc ctctgtcgga accagaggga atgacgaagc ccagggcttt tcgcagtggt       180
     gcactgtgca tcggaccacg ctcctaggcg atagtgggca agtcttctcg cagtcctctc       240
     tccaacctcc ttccgtcgga ggtaggaccg aagcgtgggc ggttgcgatt ccccagggac       300
     catggccggg tccgacacgg cgcccttcct cagccaagca gatgatcctg atgacgggcc       360
     agcgcccggc catccggggt tgccaggacc catggggaat ccaaagtccg gggaactcga       420
     ggtcccagac tgtgaggggc tacagcgcat cactggctta tctcggggcc attcgaccct       480
     catagtggtg gttctgtgct acattaacct cctgaactac atggaccgct tcaccgtggc       540
     aggggttctt acagacatcg agcagttctt taacatcgga gatggtagta ctggcctcat       600
     ccagactgtg ttcatctcca gttacatggt gttggcacca gtgtttggct acctgggtga       660
     caggtacaat cgaaagtacc tcatgtgcgg gggcattgcc ttctggtccc tggtgacact       720
     gggatcatcc ttcatcccca gagagcattt ctggctgctt ctcctgaccc ggggcctggt       780
     gggggtcggg gaggccagtt actccaccat tgcgcccacc ctgatcgccg acctcttcgt       840
     ggcagaccag cggagtcgga tgctcagtat cttctacttt gccatccctg tgggcagtgg       900
     tctaggttac attgctggct ccaaagtgaa agacgtggct ggagactggc actgggctct       960
     acgggtgaca ccaggtctag gagtgctggc tgtcctgctg ctgttcctgg tggtccagga      1020
     gcccccaaga ggagccgtgg agcgccactc aggttcacca cccctgagcc ccacctcttg      1080
     gtgggcagat ctgaaggcac tggcacgaaa tcctagtttc gtcctgtctt cccttggctt      1140
     cacctctgtg gcctttgtca cgggctccct ggctctctgg gccccagcgt tcctgctgcg      1200
     ctcccgggtt gttctgggag agactccgcc ctgtctccct ggagattcat gctcttcctc      1260
     tgacagtctc atctttggac tcatcacttg cctgactgga gtcctgggtg tgggcctggg      1320
     agtggagatc agccgccgcc ttcgccgctt caaccctcgg gctgacccac tcgtctgtgc      1380
     agctggcctc ctgggttcgg cgcctttcct cttcctggcc ctggcctgtg cccgaggtag      1440
     catcgtggcc acctatattt ttatctttat tggggagacc ctgttgtcca tgaactgggc      1500
     cattgtggct gacatcctgt tgtacgtggt gatcccaact cgacggtcca cggctgaggc      1560
     cttccagata gtgctgtccc acttgctagg agatgcaggg agcccttacc tcattggtct      1620
     aatctctgac cgcctccgac ggagctggcc cccttccttc ctgtccgagt tccgggctct      1680
     gcagttctcg ctcatgctct gtgctttcgt tggggcactg ggtggtgcgg ccttcctggg      1740
     caccgccatg ttcattgaag atgaccgccg gcgggctcaa ctccacgtgc agggtctgtt      1800
     gcatgagtct gggccctcag atgaccggat tgtagtacct cagcgaggcc gttctacccg      1860
     agtccccgtg tccagcgtgc tcatctgagg agccggtgct tacccggcca ctgatgcatc      1920
     gcagctgggc cttgggccca cccaagacgg ttcccaggca gaagccctca ccaggcccag      1980
     gtccaagaag gaagccctgg gatatctccc agctcccaga cactacatgg gcagcccagg      2040
     gaagagatgg gagtccagaa acggggaagg ggtgtcctct ctactaggac agcccaaggg      2100
     gtttggtgct atttgtaatg gaataaaatt tgtaatcaga aaaaaaaaaa aaaaaaaaaa      2160
     aaaaaaaaaa                                                             2170
//


spacer
spacer