spacer

EBI Dbfetch

ID   BC083354; SV 1; linear; mRNA; STD; MUS; 1015 BP.
XX
AC   BC083354;
XX
DT   12-OCT-2004 (Rel. 81, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 4)
XX
DE   Mus musculus prohibitin, mRNA (cDNA clone MGC:102157 IMAGE:5715690),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1015
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1015
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b48b2b4b7bdc095a4c1f98ea02895eee.
DR   Ensembl-Gn; ENSMUSG00000038845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125172; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 195 Row: c Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31560654.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1015
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FB0"
FT                   /clone="MGC:102157 IMAGE:5715690"
FT                   /tissue_type="Mouse, brain 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1015
FT                   /gene="Phb"
FT                   /note="synonym: BAP32"
FT   CDS             36..854
FT                   /codon_start=1
FT                   /gene="Phb"
FT                   /product="prohibitin"
FT                   /db_xref="GOA:P67778"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:97572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67778"
FT                   /protein_id="AAH83354.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   misc_difference 986..1015
FT                   /gene="Phb"
FT                   /note="polyA tail: 30 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1015 BP; 265 A; 261 C; 281 G; 208 T; 0 other;
     gaaagcaggt gtgagtggaa gcaacagaag gagtcatggc tgccaaagtg tttgagtcca        60
     ttggaaagtt cggcctggcg ttggcagttg caggaggcgt ggtgaactct gctttgtata       120
     atgtggatgc tggacacaga gctgtcatct ttgaccgatt ccgtggcgta caggacattg       180
     tggtcgggga agggactcat ttcctcatcc cttgggtaca gaaaccaatt atctttgact       240
     gccgctctcg accacggaac gtaccagtca tcactggtag caaagacttg cagaacgtca       300
     atatcacact gcgaatcctc ttccggccgg tggccagcca gcttcctcgt atctacacca       360
     gcattggcga ggactatgat gagcgggtcc tgccttctat caccacagag atcctcaagt       420
     cggtggtggc tcgattcgat gctggagaat tgattaccca gcgagagctg gtctccaggc       480
     aggtgagcga tgacctcaca gagcgagcgg caacatttgg gcttatcctg gatgacgtgt       540
     ccctgacaca tctgaccttc gggaaggagt tcacagaggc agtagaagcc aaacaggtgg       600
     ctcagcagga agcggagaga gccagatttg tggtggaaaa ggctgagcag cagaagaagg       660
     cagccatcat ctctgctgag ggtgactcca aggccgctga gctgatcgcc aactcgctgg       720
     ccacggcagg cgacggcctg atcgagctgc ggaagctgga ggccgccgag gacattgcgt       780
     accagctctc ccgctctcgg aacatcacct acctgccagc gggccagtcc gtgcttctcc       840
     agcttcccca gtgaggccag ccgggccacg gcctccatca tgctgaatga cgccttcctt       900
     ctgccccacc ccagaaaatc actgtgaaat ttcatgattg gcttaaagtg aaggaaataa       960
     aggtaaaatc acttcagatc tctaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa           1015
//


spacer
spacer