spacer

EBI Dbfetch

ID   BC082263; SV 1; linear; mRNA; STD; HUM; 1480 BP.
XX
AC   BC082263;
XX
DT   11-SEP-2004 (Rel. 81, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens choline kinase beta, mRNA (cDNA clone MGC:99491
DE   IMAGE:6384695), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1480
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1480
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-SEP-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 136d53f7f8d4c9ffb3840690ed44b3d8.
DR   Ensembl-Gn; ENSG00000100288; homo_sapiens.
DR   Ensembl-Tr; ENST00000406938; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: DCTD/DTP/Gazdar
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 59 Row: l Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 23238259.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1480
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_18"
FT                   /clone="MGC:99491 IMAGE:6384695"
FT                   /tissue_type="Lung, large cell carcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1480
FT                   /gene="CHKB"
FT                   /note="synonym: CHETK"
FT   CDS             56..1243
FT                   /codon_start=1
FT                   /gene="CHKB"
FT                   /product="choline kinase beta"
FT                   /db_xref="GOA:Q9Y259"
FT                   /db_xref="H-InvDB:HIT000265978.12"
FT                   /db_xref="HGNC:HGNC:1938"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:2IG7"
FT                   /db_xref="PDB:3FEG"
FT                   /db_xref="PDB:3LQ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y259"
FT                   /protein_id="AAH82263.1"
FT                   /translation="MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDA
FT                   ERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLR
FT                   LYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVL
FT                   SAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEM
FT                   GNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF
FT                   CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLV
FT                   EVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS"
FT   misc_difference 1377
FT                   /gene="CHKB"
FT                   /note="'C' in cDNA is 'T' in the human genome."
FT   misc_difference 1459..1480
FT                   /gene="CHKB"
FT                   /note="polyA tail: 22 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1480 BP; 335 A; 420 C; 431 G; 294 T; 0 other;
     cccgtccgaa gggagcggag cgcagcctgg cctggggccc ggtcgagccc gcgccatggc        60
     ggccgaggcg acagctgtgg ccggaagcgg ggctgttggc ggctgcctgg ccaaagacgg       120
     cttgcagcag tctaagtgcc cggacactac cccaaaacgg cggcgcgcct cgtcgctgtc       180
     gcgtgacgcc gagcgccgag cctaccaatg gtgccgggag tacttgggcg gggcctggcg       240
     ccgagtgcag cccgaggagc tgagggttta ccccgtgagc ggaggcctca gcaacctgct       300
     cttccgctgc tcgctcccgg accacctgcc cagcgttggc gaggagcccc gggaggtgct       360
     tctgcggctg tacggagcca tcttgcaggg cgtggactcc ctggtgctag aaagcgtgat       420
     gttcgccata cttgcggagc ggtcgctggg gccccagctg tacggagtct tcccagaggg       480
     ccggctggaa cagtacatcc caagtcggcc attgaaaact caagagcttc gagagccagt       540
     gttgtcagca gccattgcca cgaagatggc gcaatttcat ggcatggaga tgcctttcac       600
     caaggagccc cactggctgt ttgggaccat ggagcggtac ctaaaacaga tccaggacct       660
     gcccccaact ggcctccctg agatgaacct gctggagatg tacagcctga aggatgagat       720
     gggcaacctc aggaagttac tagagtctac cccatcgcca gtcgtcttct gccacaatga       780
     catccaggaa gggaacatct tgctgctctc agagccagaa aatgctgaca gcctcatgct       840
     ggtggacttc gagtacagca gttataacta taggggcttt gacattggga accatttttg       900
     tgagtgggtt tatgattata ctcacgagga atggcctttc tacaaagcaa ggcccacaga       960
     ctaccccact caagaacagc agttgcattt tattcgtcat tacctggcag aggcaaagaa      1020
     aggtgagacc ctctcccaag aggagcagag aaaactggaa gaagatttgc tggtagaagt      1080
     cagtcggtat gctctggcat cccatttctt ctggggtctg tggtccatcc tccaggcatc      1140
     catgtccacc atagaatttg gttacttgga ctatgcccag tctcggttcc agttctactt      1200
     ccagcagaag gggcagctga ccagtgtcca ctcctcatcc tgactccacc ctcccactcc      1260
     ttggatttct cctggagcct ccagggcagg accttggagg gaggaacaac gagcagaagg      1320
     ccctggcgac tgggctgagc ccccaagtga aactgaggtt caggagaccg gcctgtccct      1380
     gagtttgagt aggtccccat ggctggcagg ccagagcccc gtgctgtgta tgtaacacaa      1440
     taaacaagct tcttcttcaa aaaaaaaaaa aaaaaaaaaa                            1480
//


spacer
spacer