spacer

EBI Dbfetch

ID   BC081443; SV 1; linear; mRNA; STD; MUS; 690 BP.
XX
AC   BC081443;
XX
DT   03-SEP-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus presenilin enhancer 2 homolog (C. elegans), mRNA (cDNA clone
DE   MGC:102026 IMAGE:6814799), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-690
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-690
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-SEP-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e1f30ee75d3b21da7828b8da6ef33a1b.
DR   Ensembl-Gn; ENSMUSG00000036835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043898; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 195 Row: g Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981294.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..690
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FV0"
FT                   /clone="MGC:102026 IMAGE:6814799"
FT                   /tissue_type="Brain, mouse, 13.5, 14.5, 16.5, 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..690
FT                   /gene="Psenen"
FT   CDS             218..523
FT                   /codon_start=1
FT                   /gene="Psenen"
FT                   /product="presenilin enhancer 2 homolog (C. elegans)"
FT                   /db_xref="GOA:Q9CQR7"
FT                   /db_xref="InterPro:IPR019379"
FT                   /db_xref="MGI:MGI:1913590"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQR7"
FT                   /protein_id="AAH81443.1"
FT                   /translation="MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAP
FT                   AYTEQSQIKGYVWRSAVGFLFWVIILATWITIFQIYRPRWGALGDYLSFTIPLGTP"
FT   misc_difference 654..690
FT                   /gene="Psenen"
FT                   /note="polyA tail: 37 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 690 BP; 179 A; 184 C; 164 G; 163 T; 0 other;
     agcggagggg gtggggtgcg aggggggctg ggcaggagaa gaaaaaaaaa agcgacaaca        60
     aactccactg aaaactgcgg catctcccgc aaatctcccg caaaggaatc caggcagaag       120
     ggataaaccg cactggggcg tggttgctcg tgatcttgcg tctgtcattt gggtcttgct       180
     ctgcagaccc ttaggaccac cgggctccag cgcaactatg aacttggagc gggtatccaa       240
     tgaggagaag ttgaacctgt gccggaagta ctatcttggt ggatttgcgt tcctgccttt       300
     tctttggtta gtcaacattt tctggttctt cagagaggcg ttcctcgccc cagcctacac       360
     agagcagagc caaatcaaag gctatgtttg gcgctcagct gtgggcttcc tcttctgggt       420
     gatcattctc gccacctgga tcaccatctt ccagatctac cggccccgct ggggcgctct       480
     tggggactac ctctccttca ccattcccct gggcactccc taacaacttc ataagctgct       540
     gatctgttct ttctcccagg atgaaggctt ctctgctcta ggctttccct cagaccctga       600
     agacatctgt ttctcatttc ccatctgccc caataaagga ccctaacttt aaaaaaaaaa       660
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                                        690
//


spacer
spacer