spacer

EBI Dbfetch

ID   BC080678; SV 1; linear; mRNA; STD; MUS; 4022 BP.
XX
AC   BC080678;
XX
DT   04-SEP-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus solute carrier family 16 (monocarboxylic acid transporters),
DE   member 2, mRNA (cDNA clone MGC:91081 IMAGE:6313495), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4022
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4022
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-AUG-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000033965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042664; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 177 Row: g Column: 7.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4022
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:91081 IMAGE:6313495"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4022
FT                   /gene="Slc16a2"
FT                   /note="synonyms: Mct8, Xpct"
FT   CDS             23..1660
FT                   /codon_start=1
FT                   /gene="Slc16a2"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 2"
FT                   /db_xref="GOA:O70324"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1203732"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70324"
FT                   /protein_id="AAH80678.1"
FT                   /translation="MALPSPASEEAEGPCQEANQEYQEPVCSPVPEPEPEPEPEPEPDP
FT                   EPVPVPPPEPQPEPEPQPLPDPAPLPELGFEAEPVQEPEPTPTVETRGTARGFQPPEGG
FT                   FGWIVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFC
FT                   SPIVSIFTDRLGCRITATTGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPS
FT                   LVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIKMLGDKIKLAQTFQVLSTFMFVLTL
FT                   LSLTYRPLLPSSQDTPSKRGAHTLRQRFLVQFRKYFNMRVFRQRTYRIWAFGIAAAALG
FT                   YFVPYVHLMKYVEDKFKEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLS
FT                   FLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLL
FT                   GMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRD
FT                   SSKDKMLSHDPDPNGELLPGSPTPEEPI"
FT   misc_difference 3994..4022
FT                   /gene="Slc16a2"
FT                   /note="polyA tail: 29 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4022 BP; 929 A; 1160 C; 917 G; 1016 T; 0 other;
     cacagtcagt cccctagccg cgatggcgct gccaagcccg gcgagcgagg aagctgaggg        60
     gccctgtcag gaggcaaacc aggaatatca ggagccggtg tgtagtcctg tgcccgagcc       120
     ggagccagag ccggagcccg aaccggagcc tgaccccgag ccggtgccag tgcccccgcc       180
     cgagcctcag cctgagcccg agccccagcc cctacccgat cctgcacccc tgccggagct       240
     gggctttgag gctgagccag tgcaagaacc cgagcccacg cccactgtgg aaacccgagg       300
     caccgcgcgt ggctttcagc ctcccgaagg tggcttcggc tggatagtgg tgtttgcagc       360
     cacctggtgc aacggctcca tcttcggcat ccataactct gttggtatcc tctactccat       420
     gctactagag gaggaaaaag agaaaaatcg ccaagtggag ttccaagcag catgggtcgg       480
     agccctcgct atgggcatga tcttcttctg ttctcccatt gtgagtatat tcactgaccg       540
     tttgggctgc cgaatcacag ccaccaccgg ggccgctgtt gctttcattg gcctccacac       600
     cagctccttc accagctccc taagcctgcg ctacttcacc tatgggattc tgtttggttg       660
     tggctgctca ttcgcctttc aaccatcact cgtcatcctg ggccactact ttcaacgtcg       720
     cctaggtcta gccaatggtg tggtatctgc tggaagtagc atcttctcca tgtcttttcc       780
     cttcctcatc aaaatgctgg gggataaaat caagctggcc caaaccttcc aggtgctgag       840
     taccttcatg tttgtcctta cgctgctctc actcacttac cggcccctcc tgccaagctc       900
     ccaggacacc ccaagcaaga gaggtgccca caccctgcga cagcgctttc tggttcagtt       960
     cagaaagtac ttcaacatgc gtgtattccg ccagcgcact taccgtatct gggcctttgg      1020
     gatcgctgct gctgcccttg gttacttcgt cccctacgtg cacctgatga aatatgtgga      1080
     agataagttc aaggagatca aggagacctg ggtgctcttg gtgtgcattg gggctacgtc      1140
     aggcctcgga cgtctcgtct cgggccacat cagtgactcc atccctggac ttaagaagat      1200
     atacttgcag gtcctctcat tcctgctcct gggcttgatg tccatgatga tccccctatg      1260
     ccgggacttc gggggcctta tcgttgtctg cctcttcctg ggcctatgtg atggcttctt      1320
     cattaccatc atggctccca ttgcatttga gctggtggga cccatgcagg cctcacaggc      1380
     cattggctac ctcctgggca tgatggccct gccaatgatt gctgggcccc ccattgcagg      1440
     cctccttcga aactgctttg gtgattacca tgtggccttc tactttgcgg gtgtcccccc      1500
     aatcattgga gctgtgatcc ttttcttcgt ccctctgatg catcaaagga tgtttaagaa      1560
     agagcagaga gattccagca aggataagat gctgtcccac gatccagacc ccaacggaga      1620
     actgctgcca ggctccccaa cacctgaaga gcccatttaa tgcctctgtc ttgccattgt      1680
     gtgctccttc ccccccccac tccacccctc atcctaccct gcttagcatt tacatttttt      1740
     gccaccagca cacttgttcc caaacctgtg cacacagcat ttcagccacc tgaccatctc      1800
     ctctgagcca atgctctcgg tgttccaaac tcattaacca aattctcccc atgaatgcct      1860
     tgaaacttgc caggctcttc tcccagaatc tgggaaagtg tgggatcacc ccctggcctt      1920
     tggatcctcc cccatatata ctttctaact ctttgcgggg aggacaggga tgggatctct      1980
     agccccagat tgttagtcac ccactacaat caattgccaa aggtgctact gtgtccccag      2040
     aacccagtga gacagaccta agcctctgtt tgctgaggaa tttgttgcca tccatccttg      2100
     ggaaccattt gggaattgtg agaaggaagg ccaaaggaga ccaggagcct tgttttgcat      2160
     cgaagctcct gaggactctg cggcacccca tcatatggtt ggttagccgt ctgcttccct      2220
     tttcctttcc tagtattttc tctctacttc ctcttctccg atttcttccc ctctattcct      2280
     ttttattagt gtcatgacac ataggtgctt ggagaaagga aagacccaga gcttgggcca      2340
     atccacttca ttctgaccca gaccatccct aatattagca ttaatactgc tcatctcagg      2400
     ttgagctaca tctcactttc tgggctcaaa ctgatatgga ctggaagagc aggctatcgc      2460
     atagggatgg gaatcttcaa cactacagag ttccatgtac cagtcactga ttttgacaga      2520
     ttaaccaaga ggccttccca gtttcccatc cttcccacct gtcaaatgtg aagaaactct      2580
     tctcatctca tgaaacacag gaggaaagat gtcagtgcac tggcattaga ggagatgcta      2640
     cggttaacgg tttggggaag gaccaactcc tccgtctctc atttttcata agaggtcaat      2700
     atttccacct gggccaggcc aagaaatgaa ctgctttaag gaaaaaaaaa aaaaaaacct      2760
     cattctgtac ctggatctcc aaatgacata ggcaacaact gcacgtaggg gttggataat      2820
     ttcttttcag aaggggaagc caccctagcc tttaccaccc acccagtctg tcccccattc      2880
     taggcatcct ggaccactct gctgagtggg cattataggt gccagaaaaa gtaggctctg      2940
     gaccaccatc atccctttga agttggtgcc agatattttc ctacatccag gctctgggca      3000
     acagtcttac tgaagcacat tccaagtgcc cctggccaga ggcaaagggc actgccagcc      3060
     tcgtccagtt gtacggctca cctcattagg gactcagcct ctctcctccc tgtttctctc      3120
     tctctgtctt tgtttattgt gttcctgtac caacctttta tcatcttttt gccaggcatc      3180
     ctggctgtta cttggaccca acaataactt gccaccccaa gctagggtca tcccaaggcc      3240
     aggaagatga ggttgctctg aggggctcca aagaatacaa tggtccccac acatgagttt      3300
     ttccgttact aacaggcagc tggggcatag ttggcctctg atgtttcatt caaggccaaa      3360
     gtcctgagcc cccctctgct ggtcccaatc cagctcttat caactcccca aaggaaaacc      3420
     cattggttct tggctctgag gacaggaagg ggtggagtca ctgtcctgtc aactcaagca      3480
     tctatggaac aggagaagct gggccccagg agccctgcga ctcccaggag aggccattga      3540
     aaatactgaa gcaacaatgc ttccacttcc atttctcctt accccacccc ctccaggcca      3600
     cttagggggt agggggcaga ataagtgtgc agggcctcct ttgttgctca tggctggaca      3660
     gctctaaaga gtcaggctgc cactcacttc tctccagatg atggaaagac attcacaggt      3720
     cccagatctg cccattcagg tgtcacctaa cattggcagg gtgtcaattt acttttttat      3780
     ttttcacaaa tgcgtgtgtg cacgtgtggg cttgtgtgct ttccgagaga atgttgtttg      3840
     gccaaagcag cacagtatta atatttagag taggaagcag cctcttaggt accacagtta      3900
     aaaactaaga gaacgaacaa aatttcagag cttgagacct gggacattta aatcctcaag      3960
     gggtttggaa caaaataaac agatctaaat gtcaaaaaaa aaaaaaaaaa aaaaaaaaaa      4020
     aa                                                                     4022
//


spacer
spacer