spacer

EBI Dbfetch

ID   BC079649; SV 1; linear; mRNA; STD; MUS; 2932 BP.
XX
AC   BC079649;
XX
DT   18-AUG-2004 (Rel. 80, Created)
DT   31-MAR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus protein tyrosine phosphatase, receptor type, O, mRNA (cDNA
DE   clone IMAGE:6848644), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2932
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2932
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-AUG-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; de93a5ccd49685ac9535671624e924d0.
DR   Ensembl-Gn; ENSMUSG00000030223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077115; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 176 Row: h Column: 11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2932
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FY0"
FT                   /clone="IMAGE:6848644"
FT                   /tissue_type="Brain, mouse, 13.5,14.5,16.5,17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            <1..2932
FT                   /gene="Ptpro"
FT                   /note="synonyms: GLEPP1, PTP-BK, PTP-U2, PTPROt, PTP-phi"
FT   CDS             <1..1530
FT                   /codon_start=1
FT                   /gene="Ptpro"
FT                   /product="Ptpro protein"
FT                   /db_xref="GOA:Q68FL5"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1097152"
FT                   /db_xref="UniProtKB/TrEMBL:Q68FL5"
FT                   /protein_id="AAH79649.1"
FT                   /translation="ERGSNTSLPRLVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVADFF
FT                   EVFCQQLGSGHNGKLQEPVAVSSHVVTISSLLPATAYNCSVTSFSHDTPSVPTFIAVST
FT                   MVTEVNPNVVVISVLAILSTLLIGLLLVTLVILRKKHLQMARECGAGTFVNFASLEREG
FT                   KLPYSWRRSVFALLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTNPVQLDDFDSYIKD
FT                   MAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEE
FT                   GADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSHIIVMLTQCNEKRRVKC
FT                   DHYWPFTEEPIAYGDITVEMVSEEEEEDWASRHFRINYADEAQDVMHFNYTAWPDHGVP
FT                   PANAAESILQFVFTVRQQAAKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDIL
FT                   GLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWLRKKQQFCISDVIYENVSKS"
XX
SQ   Sequence 2932 BP; 770 A; 680 C; 680 G; 802 T; 0 other;
     gagagaggga gcaacacctc cttgccccgc cttgtcaagc tcgaaccagc ccctccgaag        60
     tcactcttcg cagtgaacaa aacacagacg tcagtgaccc tgctgtgggt tgaggagggt       120
     gttgctgatt tctttgaagt cttctgtcag cagctcggct ctggccacaa tggcaaactc       180
     caggagccag tagctgtgtc gtcccacgtg gtgaccatct ccagcctcct cccagccact       240
     gcctacaact gcagtgtcac cagcttcagc cacgacactc ccagtgtccc tacattcata       300
     gctgtctcca caatggttac agaggtgaac cctaacgtgg tggtgatctc ggtgctggcc       360
     atcctcagca cacttttaat tggactgctc ttagtgaccc ttgtcattct ccgaaagaag       420
     cacctgcaga tggctaggga atgtggagct ggcacgtttg ttaactttgc atccttagaa       480
     agggaaggga aactccccta cagttggcgt aggagtgtgt ttgctctctt aaccctgctg       540
     ccttcatgtc tttggactga ctatcttttg gcattttata ttaacccttg gagtaaaaat       600
     ggcttaaaga agaggaaact aacaaacccc gttcagctgg atgacttcga ttcttacatc       660
     aaggatatgg ccaaggactc ggactataaa ttctctcttc agtttgagga gttgaagttg       720
     attggactgg atattccgca ctttgctgca gatctaccgc tgaaccgatg taaaaaccgc       780
     tacacaaaca tcctgccgta tgactttagc cgggtgaggc tagtctccat gaacgaagag       840
     gaaggagcag actacattaa tgccaactat attcctggat acaactcacc ccaggagtac       900
     attgccaccc agggtcccct gccagaaacc agaaatgact tctggaagat ggtcctacaa       960
     cagaagtccc acatcatcgt catgctcact caatgcaatg agaaaaggag ggtaaaatgt      1020
     gaccactact ggccattcac agaagaaccc attgcttatg gggacatcac cgtggagatg      1080
     gtctctgagg aagaggagga ggactgggcc agtagacact tccggatcaa ctatgcggac      1140
     gaagcgcagg acgtgatgca ttttaactac acagcctggc ccgatcacgg cgtgcctcca      1200
     gcaaacgccg ccgagagcat cctgcagttt gtgttcacag tgcgacagca agccgccaag      1260
     agcaaagggc ccatgatcat ccactgcagt gcgggtgtgg gacggacagg aaccttcatt      1320
     gccctggaca ggctcctgca acacattcga gatcatgaat ttgtggacat cttagggctg      1380
     gtatcagaga tgcgctcata ccgaatgtca atggtacaga cagaggagca gtacattttt      1440
     atccatcagt gtgtgcagct gatgtggctg aggaagaagc aacagttctg catcagcgac      1500
     gtcatctacg agaacgtcag caaatcctag ttcggaatct ggagcggtga ggacatgata      1560
     cctgcgcatc ctcccttgct tccagagttt ttataggggc ttttagtcac tttgctaaat      1620
     cgagtccctg ctgtgcagta tatggacaag gaggagattt acctcctaga accaagaaga      1680
     ccttaaggag cctacagtat catttggagt cttttcactt ctagatgttt gatggaccaa      1740
     attcagtaga attccagaaa ggtcaccaat gctccttgag gggcaggaag cgcaatactt      1800
     cctgatggct cagttggctc tttgctgctc gggttgggtt gatttttttt ttaagtgcaa      1860
     taatttctgt ataattgtga ttttttacat tcacaattca gaatgttgaa ttgttatctg      1920
     cccacaccat cgatcagtgc cacagccttg gaaataacca acatcattac ggagttttat      1980
     ctcatccctg gaaaggcatg agataaaact ccgtaatgat gttggcaata cttcctgatg      2040
     gctcagttgg ctctttgctg ctcgggttgg gttgattttt tttttaagtg caataatttc      2100
     tgtataattg tgatttttta cattcacaat tcagaatgtt gaattgttat ctgcccacac      2160
     catcgatcag tgccacagcc ttggaaataa ccaacatcat tacggagttt tatctcatcc      2220
     ctggaaaggc atggctacac aggaagacgt ggtgatgaat ctccttcaaa gaaactgagc      2280
     gagtgtgctc ctcgctccaa ccttgaagct acgggtcagg agtaggcagg cagagggaag      2340
     agagcggttc tactcaccca tcagccagct tatcttttcc tatttcaaat atgaaaacct      2400
     gtgtttcaaa gtagagtagg aaaaacatta tatgtctgac ttgtcatagt gggtttcttc      2460
     cttgttgaca gttgggagtt tcttccgtgg ctcttttgaa ctaatgtcac ggtccttttt      2520
     gaacagccag agttgattca acagttttga gtctgactct gaactctgag atatcttggt      2580
     gcctagcctt cacgtttatt tttctctgtg tccacctgtg tacacaaaaa cagtttctcc      2640
     aagagctata ggctgtaaaa atgcactttc tttctccacc cagaggagct gggaattcag      2700
     aagtcacgac aacaacaaac tcagcatgta aggacaggta ttggacacca tcccttaaga      2760
     acattgttga gtgtctctat ggattccgac aggagattct ctgggtcttc tttgcatttc      2820
     tgttgtcaga gtcattttaa cctgtgtagc tagtggcatt atattctttg gattttgtat      2880
     gattaaagta catgattgtg tgttgtgacc atgaaaaaaa aaaaaaaaaa aa              2932
//


spacer
spacer