spacer

EBI Dbfetch

ID   BC079611; SV 1; linear; mRNA; STD; MUS; 1777 BP.
XX
AC   BC079611;
XX
DT   04-AUG-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus LIM domain binding 2, mRNA (cDNA clone MGC:90639
DE   IMAGE:30360903), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1777
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1777
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-AUG-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8e5bf4a051241b30b3a81455d36480b7.
DR   Ensembl-Gn; ENSMUSG00000039706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070748; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. James Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 176 Row: m Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 13443027.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1777
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_GM0"
FT                   /clone="MGC:90639 IMAGE:30360903"
FT                   /tissue_type="Brain"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1777
FT                   /gene="Ldb2"
FT                   /note="synonyms: Ldb3, CLIM1, CLP-36"
FT   CDS             147..1268
FT                   /codon_start=1
FT                   /gene="Ldb2"
FT                   /product="LIM domain binding 2"
FT                   /db_xref="GOA:O55203"
FT                   /db_xref="InterPro:IPR002691"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="MGI:MGI:894670"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55203"
FT                   /protein_id="AAH79611.1"
FT                   /translation="MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTED
FT                   SDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYIL
FT                   KHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIR
FT                   QYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKT
FT                   YNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGS
FT                   KKKTPAASLSLATQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDF
FT                   NNSPALGNNSPWNSKPPATQETKSENAPPQASQ"
FT   misc_difference 1762..1777
FT                   /gene="Ldb2"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1777 BP; 518 A; 450 C; 399 G; 410 T; 0 other;
     tgcctgcctg cctgcctctg tgtgtgtctg tgtgtgtgtg agcgtgtgtg cgtgcgtcta        60
     ctttgtactg tgaagaacac agcccatgtg ctctgcatgg acgttcctga tactctatta       120
     agcttgattt tcgacaagca ggcaagatgt ccagcacacc acatgacccc ttctattctt       180
     ctcctttcgg cccattttat aggagacata caccatacat ggtacagcca gagtaccgaa       240
     tctatgagat gaacaagaga ctgcagtctc gtacagagga cagtgacaac ctctggtggg       300
     atgcgtttgc cactgaattt tttgaagatg atgccacatt aacactttca ttttgtttgg       360
     aagacggacc aaagcgatac actatcggca ggaccctcat tccccgttat tttagcaccg       420
     tatttgaagg aggggtgaca gacctgtact acatccttaa acactcaaag gagtcatatc       480
     acaactcatc catcacagta gactgcgacc agtgtgccat ggtcacacag catgggaagc       540
     ccatgtttac caaggtatgc acagaaggca ggctgatctt ggaattcaca tttgatgacc       600
     tcatgagaat aaaaacgtgg cactttacca ttagacagta cagggagctg gtccccagaa       660
     gcatactagc catgcacgca caagatcctc aggtcctgga tcagctgtcc aaaaatatca       720
     ccaggatggg tctcacaaac ttcaccctca actacctcag gttgtgtgta atactggagc       780
     caatgcagga actgatgtcg agacacaaaa cctacaacct cagtccccga gactgcctga       840
     agacctgtct gtttcagaag tggcagcgga tggtggcccc gccagcagaa cccacaaggc       900
     aaccgacaac caaaaggaga aaacgaaaaa actccacaag cagcacgtcc aatagcagtg       960
     ccgggaacac gaccaacagt gccggcagca agaagaagac cccggcggca agcctgagcc      1020
     tggccactca ggtacctgat gtgatggtgg taggagagcc aactctgatg ggaggtgagt      1080
     ttggggacga ggacgaaagg ctaatcacta gattagaaaa cacgcagtat gatgcggcca      1140
     acggcatgga cgacgaagaa gacttcaaca attcacctgc cctggggaac aacagcccgt      1200
     ggaacagtaa acctcccgcc acgcaagaga ccaaatcaga aaacgcccca ccccaggctt      1260
     cccagtaaga tgggctactg gcacctgatt acgctgtcca taggcccgtg gggtagaatt      1320
     ccattcgcaa atctctacta tcaggagaga aaagagatga aatttaaaac acacaagcaa      1380
     aacgtttcca tgtaaacatc tatttctaaa cttatataat gacctgattt tctttcttgc      1440
     aatttttccc cctttttaat tgagaggatc gttcgaatga gcctctgtgg cctctcctta      1500
     gaggccttca caagaagcat agacactgtc cctgacggta attagaagaa gcagaggctc      1560
     acacatctcc tggcacggtc ttatctccct cgtgtgttga acttgctgtc cgtccatgca      1620
     ccctacgaag gccatgctgt gcaaacgtgc tcaggatctc agtaacgggc caacccccaa      1680
     ctacagatga ctttttaata ttgtaaaata ttttctgctt ttttgacttg catttgagag      1740
     tttcttgttt cagtaaaaaa aaaaaaaaaa aaaaaaa                               1777
//


spacer
spacer