Dbfetch

ID   BC079566; SV 1; linear; mRNA; STD; MUS; 4267 BP.
XX
AC   BC079566;
XX
DT   04-AUG-2004 (Rel. 80, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus glutamate receptor, metabotropic 1, mRNA (cDNA clone MGC:90744
DE   IMAGE:30536724), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4267
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4267
RA   Director MGC Project;
RT   ;
RL   Submitted (02-AUG-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 8cfe86bd5157ea7382315846cafdd2c4.
DR   Ensembl-Gn; ENSMUSG00000019828; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017011; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016989; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016953; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016947; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016772; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017409; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016354; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016744; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016852; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016847; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016927; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016877; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017447; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016139; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016416; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000044306; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105561; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0024565; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0024531; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0024500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0024501; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0024311; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025011; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0023854; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0024240; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0024364; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0024364; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0024482; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0024353; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025050; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0023563; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0023867; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. James Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 176 Row: o Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328062.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4267
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_GH0"
FT                   /clone="MGC:90744 IMAGE:30536724"
FT                   /tissue_type="Brain"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4267
FT                   /gene="Grm1"
FT                   /note="synonyms: mGluR1, 4930455H15Rik"
FT   CDS             419..3139
FT                   /codon_start=1
FT                   /gene="Grm1"
FT                   /product="Grm1 protein"
FT                   /db_xref="GOA:P97772"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001256"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR019588"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97772"
FT                   /protein_id="AAH79566.1"
FT                   /translation="MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDV
FT                   IIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSE
FT                   IRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPG
FT                   SSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRY
FT                   NWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERL
FT                   PKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITI
FT                   KLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNES
FT                   LEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGYVGLCDAMKPIDGRKLLDFLIKSS
FT                   FVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKS
FT                   GMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEFTCRACDLGWWPNAELT
FT                   GCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIIL
FT                   AGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKIC
FT                   TRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGV
FT                   VAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKI
FT                   ITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNT
FT                   FLNIFRRKKPGAGNAKKRQPEFSPSSQCPSAHVQL"
XX
SQ   Sequence 4267 BP; 1038 A; 1172 C; 1133 G; 924 T; 0 other;
     gtgaagcgga ccggacaata tttagcatcc cagaccctgg agtttaaaat acaattcctc        60
     cggtagcctg gcattgactt ccctcttttt ccaccatcag cgtccagctt atggccacta       120
     acgcgccgct cattgcacac ctgattcaca caccttcggg caccagtgaa aaaaccgcga       180
     cttgattttc tggaagaaca cccctagggt ttgggagcgg tcgtggagga ccagcaggaa       240
     gaagcggagg ggagaggggc ggtggtggag actgagaagc tttgaaccag ctgtgttggc       300
     caaaggcacg aagcggcaaa agacagcggc gggcgtcagg gtggttcgcg ctgggaacct       360
     gcaggcggga ccggcgtggg aacgtggctt gccggcggtc gaccgcgtct tcgccacaat       420
     ggtccggctc ctcttgattt tcttcccaat gatctttttg gagatgtcca ttttgcccag       480
     gatgcctgac agaaaagtac tgctggcagg tgcctcgtcc cagcgctctg tggcgagaat       540
     ggacggagat gtcatcatcg gagccctctt ctcagtccat caccagcctc cagccgaaaa       600
     ggtaccggaa aggaagtgtg gggagatcag agaacagtat ggtatccaga gagtggaggc       660
     catgttccac acattagata agattaatgc ggacccggtg ctcctgccca acatcactct       720
     gggcagtgag atccgggact cctgctggca ctcttctgtg gctctggaac agagcattga       780
     gttcatcaga gactccctga tttccatccg agatgagaag gatggactga accgctgcct       840
     gcctgatggc cagaccctac ccccaggcag gactaagaag cctattgctg gagtgatcgg       900
     ccctggctcc agctctgtgg ccattcaagt ccagaatctt ctgcagctgt tcgacatccc       960
     acaaatcgcc tattctgcca cgagcataga cctgagcgac aaaactttgt acaaatactt      1020
     cctgagggtg gtcccttctg acactttgca ggcaagggcg atgcttgata tcgtcaagcg      1080
     gtacaactgg acctatgtct ctgcagtcca cacagaaggg aattacggcg agagtggaat      1140
     ggatgctttc aaagagttgg ctgcccagga aggactctgc atcgcacact cggacaaaat      1200
     ctacagcaat gctggcgaga agagctttga tcggcttctg cgcaagctcc gagagcggct      1260
     tcccaaggcc agggttgtgg tctgcttctg cgagggcatg acagtgcggg ggttactgag      1320
     tgccatgcgc cgccttggcg tcgtgggaga gttctcactc attggaagtg atggatgggc      1380
     agacagagat gaagtcatcg aaggctatga ggtggaagcc aatgggggaa tcacaataaa      1440
     gctgcagtct ccagaggtca ggtcgtttga tgactacttt ctgaagctga ggctggacac      1500
     caacacgagg aatccttggt tccctgagtt ctggcaacat cgcttccagt gtcgcctacc      1560
     tggacacctc ttggaaaacc ccaactttaa aaaagtctgc acaggaaatg aaagcttgga      1620
     agaaaattat gtccaggaca gcaaaatggg atttgtcatc aacgccatct atgccatggc      1680
     acacggccta cagaacatgc accatgctct atgtcctggc tacgtgggcc tttgtgatgc      1740
     catgaagccc attgacggca ggaagctcct ggatttcctc atcaaatcct cttttgttgg      1800
     agtgtctgga gaggaggtct ggttcgatga gaagggggat gcacctggaa ggtatgacat      1860
     tatgaatctg cagtacacag aggctaatcg ctatgactat gtccatgtgg gaacctggca      1920
     tgaaggtgtg ctgaatatcg atgattacaa aatccagatg aacaaaagcg gaatggtacg      1980
     atctgtgtgc agcgagcctt gcttaaaggg tcagattaag gtcatacgga aaggggaagt      2040
     gagctgctgc tggatctgca cagcctgcaa agagaatgag tttgtgcaag atgagtttac      2100
     ctgcagagcc tgtgacctgg ggtggtggcc caatgcagag ctcacaggct gtgagcccat      2160
     tactatccgt tacctcgagt ggagtgacat agaatccatc atagccatcg ccttttcttg      2220
     cctgggcatc ctcgtgacgc tatttgtcac cctcatcttt gtgctgtacc gggacacacc      2280
     tgtggtcaaa tcctccagta gagagctctg ctatatcatt ctggctggta ttttcctcgg      2340
     ctacgtatgc cctttcaccc tcatcgccaa acctactacc acatcctgct acctccagcg      2400
     cctcctagtt ggcctctctt ctgccatgtg ctactctgct cttgtgacca aaaccaatcg      2460
     tattgcacgc atcctggctg gcagcaagaa gaagatctgt acccggaagc ccaggttcat      2520
     gagcgcttgg gcccaagtga tcatagcctc cattctgatt agtgtacagc tgacactagt      2580
     ggtgaccttg atcatcatgg agcctcccat gcccattttg tcctacccga gcatcaagga      2640
     agtctatctt atctgcaata ccagcaacct gggtgtagtg gcacctgtgg gttacaacgg      2700
     acttctcatc atgagctgta cctactatgc cttcaagacc cgcaacgtgc cggccaattt      2760
     caatgaggct aaatacatcg ccttcactat gtacaccacc tgcatcatct ggctggcttt      2820
     tgttcccatt tactttggga gcaactacaa gattatcact acctgcttcg cagtgagcct      2880
     cagtgtgacg gtggccctgg gctgcatgtt cactcccaag atgtacatca ttattgccaa      2940
     acccgagagg aatgtccgca gtgccttcac cacctctgat gtagtgcgca tgcacgtcgg      3000
     tgacggcaag ctgccatgcc gctccaacac cttcctcaac attttccgga gaaagaagcc      3060
     tggggcaggg aacgccaaga agaggcagcc agaattctcg cccagcagcc agtgtccgtc      3120
     ggcacatgtg cagctttgaa aacccccaca ctgcagtgaa tgtttctaac ggcaagtctg      3180
     tgtcatggtc tgaaccaggt ggaagacagg cgcccaaggg acagcatgtg tggcagcgcc      3240
     tctctgtgca cgtgaagacc aatgagacgg cctgtaacca aacagccgta attaaacccc      3300
     tcactaaaag ttaccaaggc tctggcaaga gtctgacctt ttcagacgcc agcaccaaga      3360
     ccctttacaa cgtggaggaa gaggacaata ccccttcaac tcacttcagc cctcccagca      3420
     gcccttccat ggtggtgcac cgacgcgggc cacccgtggc caccacgcca cctctgccac      3480
     cccaccttag cgcagaagag acgcccttgt tcctggctga ttctgtcatc cccaagggct      3540
     tgcctcctcc tctcccgcag cagcaacagc agccgccccc tcagccgcct ccgcagcagc      3600
     ccaaatccct gatggaccag ctgcaaggcg tggtcaccaa ctttggctct gggattccag      3660
     acttccacgc ggtgctggca ggcccgggga caccagggaa cgggctgcgc tccctgtacc      3720
     cgcccccgcc tccaccgcaa cacctgcaga tgttgcccct gcagctgagc accttccgag      3780
     aggagcccat ctcccctccg ggggaggacg acgatgatga cagcagcgag aggttcaagc      3840
     tcctgcagga gttcgtgtat gagcgtgaag ggaacacgga ggaagacgat ctggaagagg      3900
     aggaggacct gcctgcagcc agcaagctga cgcctgagga ttcgcctgcc ctgacgcccc      3960
     cttctccttt ccgagattcc gtggcctctg gcagctcagt gcccagttcc ccagtgtctg      4020
     agtcagtgct ctgcacccct ccaaatgtga cctatgcctc tgtcattctg agggactaca      4080
     agcaaagctc ttccactctg tagtaagggg ggagtatgcg tggagaagcc agagatgcca      4140
     aggagtgtca accctttcag aaatgtgtag aaagcaaggg ggtggggtgg gatggaggac      4200
     cacagtctgc agggaagaaa aaaaagaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      4260
     aaaaaaa                                                                4267
//