spacer

EBI Dbfetch

ID   BC075668; SV 1; linear; mRNA; STD; MUS; 1684 BP.
XX
AC   BC075668;
XX
DT   02-JUL-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus clusterin, mRNA (cDNA clone MGC:99970 IMAGE:30550773),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1684
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1684
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-JUN-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 42a87cc6a9693c63fb96cc138cc14488.
DR   Ensembl-Gn; ENSMUSG00000022037; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022616; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 7304966.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1684
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_HA0"
FT                   /clone="MGC:99970 IMAGE:30550773"
FT                   /tissue_type="Eye"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1684
FT                   /gene="Clu"
FT                   /note="synonyms: SP-40, Sgp-2, ApoJ, Sgp2"
FT   CDS             63..1409
FT                   /codon_start=1
FT                   /gene="Clu"
FT                   /product="clusterin"
FT                   /db_xref="GOA:Q06890"
FT                   /db_xref="InterPro:IPR000753"
FT                   /db_xref="InterPro:IPR016014"
FT                   /db_xref="InterPro:IPR016015"
FT                   /db_xref="InterPro:IPR016016"
FT                   /db_xref="MGI:MGI:88423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06890"
FT                   /protein_id="AAH75668.1"
FT                   /translation="MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEI
FT                   QNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNET
FT                   MMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLE
FT                   SDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKS
FT                   RLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDR
FT                   TVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQY
FT                   KELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPS
FT                   RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE"
FT   misc_difference 1489
FT                   /gene="Clu"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1640..1684
FT                   /gene="Clu"
FT                   /note="polyA tail: 45 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1684 BP; 453 A; 471 C; 430 G; 330 T; 0 other;
     ccaggaggag cgcactggag ccaagccgca gaccggactc cagattccaa ggaggccacg        60
     ccatgaagat tctcctgctg tgcgtggcac tgctgctgat ctgggacaat ggcatggtcc       120
     tgggagagca ggaggtctct gacaatgagc tccaagaact gtccactcaa gggagtaggt       180
     atattaataa ggagattcag aacgccgtcc agggagtgaa gcacataaaa actctcatag       240
     aaaaaaccaa cgcagagcgc aagtccttgc tcaacagttt agaggaagcc aagaagaaga       300
     aagaggatgc tctggaggac actagggatt ctgaaatgaa gctgaaggca ttcccggaag       360
     tgtgtaacga gaccatgatg gccctctggg aggagtgcaa gccctgcctg aagcatacct       420
     gcatgaagtt ctatgcacgt gtctgcagga gcggctcagg gctggtcggc cagcagctag       480
     aggagtttct aaaccagagc tcacccttct acttctggat gaacggcgac cgcatcgact       540
     ccctgctgga gagtgaccgg cagcagagcc aagtcctgga tgccatgcag gacagctttg       600
     ctcgggcatc tggcatcata gacacgctct ttcaggaccg gttcttcgcc cgtgagcttc       660
     atgaccccca ctacttctcc cccatcggct tcccacacaa gaggcctcat ttcttatatc       720
     ccaagtcccg cttggtccgc agcctcatgt ctccctccca ctatgggcct ccgagcttcc       780
     acaacatgtt ccagcctttc tttgagatga tccaccaggc tcaacaggcc atggatgtcc       840
     agctccacag cccagccttc cagttcccag acgtggattt cttaagagaa ggtgaagatg       900
     accgcactgt gtgcaaggag atccgccgca actccacagg atgcctgaag atgaagggcc       960
     agtgtgaaaa gtgccaggag atcttgtctg tggactgttc aaccaacaat cctgcccagg      1020
     ctaacctgcg ccaggagctg aacgactcgc tccaggtggc cgagaggctg acagagcagt      1080
     acaaggagct gctgcagtcc ttccagtcga agatgctcaa cacctcatcc ctgctggagc      1140
     agctgaacga ccagttcaac tgggtgtccc agctggctaa cctcacacag ggcgaagaca      1200
     agtactacct tcgggtctcc accgtgacca cccattcctc tgactcagag gtcccctccc      1260
     gtgtcactga ggtggtggtg aagctgtttg actctgaccc catcacagtg gtgttaccag      1320
     aagaagtctc taaggataac cctaagttta tggacacagt ggcggagaag gcgctacagg      1380
     aataccgcag gaaaagccgt gcggaatgag atagaagcat caccttccta tatgtaggag      1440
     tgtctgggag ggaatctccc agctccccga ggtggctgca gacccctata gaactccaca      1500
     tgtctccagg cgagtaggcc tcacccaagc agcctgccct tcctctggat tctgtacact      1560
     aatgcctgca cttgctgctc tcgggaagaa ctgattcccc cacgcaacta atccaataaa      1620
     agccgccttg cgatacgtga aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1680
     aaaa                                                                   1684
//


spacer
spacer