spacer

EBI Dbfetch

ID   BC070409; SV 1; linear; mRNA; STD; MUS; 3140 BP.
XX
AC   BC070409;
XX
DT   12-MAY-2004 (Rel. 79, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus amyloid beta (A4) precursor protein, mRNA (cDNA clone
DE   MGC:95575 IMAGE:5708093), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3140
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3140
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-MAY-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 65d227daef49eff7f4baf978411c7ccb.
DR   Ensembl-Gn; ENSMUSG00000022892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005406; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 47271503.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3140
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EW0"
FT                   /clone="MGC:95575 IMAGE:5708093"
FT                   /tissue_type="Brain, mouse 15.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..3140
FT                   /gene="App"
FT                   /note="synonyms: betaAPP, Abeta, appican, amyloid"
FT   CDS             146..2233
FT                   /codon_start=1
FT                   /gene="App"
FT                   /product="amyloid beta (A4) precursor protein"
FT                   /db_xref="GOA:Q6GR78"
FT                   /db_xref="InterPro:IPR008154"
FT                   /db_xref="InterPro:IPR008155"
FT                   /db_xref="InterPro:IPR011178"
FT                   /db_xref="InterPro:IPR013803"
FT                   /db_xref="InterPro:IPR015849"
FT                   /db_xref="InterPro:IPR019543"
FT                   /db_xref="InterPro:IPR019744"
FT                   /db_xref="InterPro:IPR019745"
FT                   /db_xref="InterPro:IPR024329"
FT                   /db_xref="InterPro:IPR028866"
FT                   /db_xref="MGI:MGI:88059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GR78"
FT                   /protein_id="AAH70409.1"
FT                   /translation="MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHM
FT                   NVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQ
FT                   CKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST
FT                   NLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGE
FT                   DKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTE
FT                   SVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEE
FT                   AERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALE
FT                   NYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTH
FT                   LRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDA
FT                   LMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLT
FT                   TRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGV
FT                   VIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ
FT                   N"
FT   misc_difference 3122..3140
FT                   /gene="App"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3140 BP; 855 A; 772 C; 821 G; 692 T; 0 other;
     gtttcctcgg cggcgggagg cgagagcacc gggagcagag cgagcgcggg gccaccggag        60
     acggcggcgg cggcgcggac acagccaggg cgcggcggat cttccactcg cacacggagc       120
     actcggtggc ccacgcagga tcacgatgct gcccagcttg gcactgctcc tgctggccgc       180
     ctggacggtt cgggctctgg aggtacccac tgatggcaac gccgggctgc tggcagaacc       240
     ccagatcgcc atgttctgtg gtaaactcaa catgcacatg aatgtgcaga atggaaagtg       300
     ggagtcagac ccgtcaggga ccaaaacctg cattggcacc aaggagggca tcttgcagta       360
     ctgccaagag gtctaccctg aactgcagat cacaaacgtg gtggaagcca accagccagt       420
     gaccatccag aactggtgca agcggggccg caagcagtgc aagacacaca cccacatcgt       480
     gattccttac cgttgcctag ttggtgagtt tgtgagcgac gcccttctcg tgcccgacaa       540
     gtgcaagttc ctacaccagg agcggatgga tgtttgtgag acccatcttc actggcacac       600
     cgtcgccaaa gagacatgca gcgagaagag cactaacttg cacgactatg gcatgctgct       660
     gccctgcggc atcgacaagt tccgaggggt agagtttgta tgctgcccgt tggccgagga       720
     aagcgacagc gtggattctg cggatgcaga ggaggatgac tctgatgtct ggtggggtgg       780
     agcggacaca gactacgctg atggcggtga agacaaagta gtagaagtcg ccgaagagga       840
     ggaagtggct gatgttgagg aagaggaagc tgatgatgat gaggatgtgg aggatgggga       900
     cgaggtggag gaggaggccg aggagcccta cgaagaggcc accgagagaa caaccagcac       960
     tgccaccacc accacaacca ccactgagtc cgtggaggag gtggtccgag ttcccacgac      1020
     agcagccagc acccccgacg ccgtcgacaa gtacctggag acacccgggg acgagaacga      1080
     gcatgcccat ttccagaaag ccaaagagag gctggaagcc aagcaccgag agagaatgtc      1140
     ccaggtcatg agagaatggg aagaggcaga gcgtcaagcc aagaacttgc ccaaagctga      1200
     caagaaggcc gttatccagc atttccagga gaaagtggaa tctctggaac aggaagcagc      1260
     caatgagaga cagcagcttg tagagacaca catggccaga gttgaagcca tgctcaatga      1320
     ccgccgccgc ctggccctcg agaattacat cactgcactg caggcggtgc ccccaaggcc      1380
     tcatcatgtg ttcaacatgc tgaagaagta cgtccgtgcg gagcagaaag acagacagca      1440
     caccctaaag cattttgaac atgtgcgcat ggtggacccc aagaaagctg ctcagatccg      1500
     gtcccaggtt atgacacacc tccgtgtgat ctacgagcgc atgaaccagt ctctgtccct      1560
     gctctacaat gtccctgcgg tggctgagga gattcaagat gaagtcgatg agctgcttca      1620
     gaaggagcag aactactccg acgatgtctt ggccaacatg atcagtgagc ccagaatcag      1680
     ctacggaaac gacgctctca tgccttcgct gacggaaacc aagaccaccg tggagctcct      1740
     tcccgtgaat ggggaattca gcctggatga cctccagccg tggcaccctt ttggggtgga      1800
     ctctgtgcca gccaataccg aaaatgaagt cgagcctgtt gacgcccgcc ccgctgctga      1860
     ccgaggactg accactcgac caggttctgg gctgacaaac atcaagacgg aagagatctc      1920
     ggaagtgaag atggatgcag aattcggaca tgattcagga tttgaagtcc gccatcaaaa      1980
     actggtgttc tttgctgaag atgtgggttc gaacaaaggc gccatcatcg gactcatggt      2040
     gggcggcgtt gtcatagcaa ccgtgattgt catcaccctg gtgatgttga agaagaaaca      2100
     gtacacatcc atccatcatg gcgtggtgga ggtcgacgcc gccgtgaccc cagaggagcg      2160
     ccatctctcc aagatgcagc agaacggata tgagaatcca acttacaagt tctttgagca      2220
     aatgcagaac taagccccac ccgcgccaca gcagcggcct ctgaacttgg acagcgaaac      2280
     cattgcttca ctacccatcg gtgttcattt ataaaataac gtggaaagaa acaaaccctt      2340
     ccgtttattt actcaccctc ggcttttgac agctgtgctg taacacaagt agatgcctga      2400
     acttgaatta atatacaaat cagtaatgta ttctcgcttt ctctctttac attctggtct      2460
     ctacattaca tgattcatgg gttttgtgta ctgtaaaaaa aaaaattagc tgtatcaaac      2520
     tagtgcatga atagattctc tcctaattat ttatcacata catagcccct tagcccgttg      2580
     tatattattc ttgtggtttg tggcccggaa aaaactccta cttgaaatat gctttaaaaa      2640
     tcgatggggg atgcttcttg tgaacgtggg cgtctagctg cttctcctac gtattctttt      2700
     cctgatcact atgcattttg aacatttttt taagtattcc aaatgactta gaaaattctt      2760
     tttccatgac tgcatcttac tgtacagatt gctgcttctg ctctctttgt gatataggaa      2820
     taagaggata cacattgatt tctttgtgcc tgttttatgt gcacacatta ggcattgaga      2880
     atttgaacat tttttttgtc catgtatctt tggatctttg ataaaaaaaa attaaaaaaa      2940
     aattatccct gttcatcata agcactttta cgggtggggg gagggagtgt tctgctggtc      3000
     tccaattacc aagaattctc caaaaattaa ttttctgcag gatgattgta cagaatcatt      3060
     gcttatgcca tgatagcttt ctacactgta ttacataaat aaattaaata aaataactcc      3120
     aaaaaaaaaa aaaaaaaaaa                                                  3140
//


spacer
spacer