spacer

EBI Dbfetch

ID   BC070398; SV 1; linear; mRNA; STD; MUS; 3191 BP.
XX
AC   BC070398;
XX
DT   12-MAY-2004 (Rel. 79, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus peroxisome proliferator activator receptor delta, mRNA (cDNA
DE   clone MGC:86084 IMAGE:5694282), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3191
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3191
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-MAY-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8ab390db8fa185f9a07a318f1a1a70fb.
DR   Ensembl-Gn; ENSMUSG00000002250; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002320; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 47271509.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3191
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EH0p"
FT                   /clone="MGC:86084 IMAGE:5694282"
FT                   /tissue_type="Brain, day 18.5pc (3 -4 kb fragment)"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..3191
FT                   /gene="Ppard"
FT                   /note="synonyms: NUC-1, Nr1c2, PPAR[b], PPAR-beta, NUC1,
FT                   Pparb, PPAR-delta, Pparb/d, PPARdelta"
FT   CDS             227..1549
FT                   /codon_start=1
FT                   /gene="Ppard"
FT                   /product="peroxisome proliferator activator receptor delta"
FT                   /db_xref="GOA:P35396"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003075"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:101884"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35396"
FT                   /protein_id="AAH70398.1"
FT                   /translation="MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLS
FT                   QNSSPSSLLDQLQMGCDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMK
FT                   LEYEKCDRICKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASE
FT                   GCQHNPQLADLKAFSKHIYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAE
FT                   KGLVWKQLVNGLPPYNEISVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLL
FT                   KYGVHEAIFAMLASIVNKDGLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNAL
FT                   ELDDSDLALFIAAIILCGDRPGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLL
FT                   QKMADLRQLVTEHAQMMQWLKKTESETLLHPLLQEIYKDMY"
FT   misc_difference 1292
FT                   /gene="Ppard"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 3170..3191
FT                   /gene="Ppard"
FT                   /note="polyA tail: 22 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3191 BP; 687 A; 1060 C; 824 G; 620 T; 0 other;
     agctggggga ttctgcggag cctgcgggac ggcggcagcg gcgcgagagg cggccgggac        60
     agtgctgtgc agcggtgtgg gtatgcgcat gggactcact cagaggctcc tgctcactga       120
     cagatgaaga caaacccacg gtaaaggcag tccatctgcg ctcagaccca gatggtggca       180
     gagctatgac caggcctgca ggcgccacgc caagtggggg tcagtcatgg aacagccaca       240
     ggaggagacc cctgaggccc gggaagagga gaaagaggaa gtggccatgg gtgacggagc       300
     cccggagctc aatgggggac cagaacacac gcttccttcc agcagctgtg cagacctctc       360
     ccagaattcc tccccttcct ccctgctgga ccagctgcag atgggctgtg atggggcctc       420
     aggcggcagc ctcaacatgg aatgtcgggt gtgcggggac aaggcctcgg gcttccacta       480
     cggggtccac gcgtgcgagg ggtgcaaggg cttcttccgc cggacaatcc gcatgaagct       540
     cgagtatgag aagtgcgatc ggatctgcaa gatccagaag aagaaccgca acaagtgtca       600
     gtactgccgc ttccagaagt gcctggcact cggcatgtcg cacaacgcta tccgctttgg       660
     acggatgccg gaggccgaga agaggaagct ggtggcgggg ctgactgcca gcgaggggtg       720
     ccagcacaac ccccagctgg ccgacctgaa ggccttctct aagcacatct acaacgccta       780
     cctgaaaaac ttcaacatga ccaaaaagaa ggcccggagc atcctcaccg gcaagtccag       840
     ccacaacgca ccctttgtca tccacgacat cgagacactg tggcaggcag agaagggcct       900
     ggtgtggaaa cagctggtga acgggctgcc gccctacaac gagatcagtg tgcacgtgtt       960
     ctaccgctgc cagtccacca cagtggagac agtccgagag ctcaccgagt tcgccaagaa      1020
     catccccaac ttcagcagcc tcttcctcaa tgaccaggtg accctcctca agtatggcgt      1080
     gcacgaggcc atctttgcca tgctggcctc catcgtcaac aaagacgggc tgctggtggc      1140
     caacggcagt ggcttcgtca cccacgagtt cttgcgaagt ctccgcaagc ccttcagtga      1200
     catcattgag cccaagttcg agtttgctgt caagttcaat gcgctggagc tcgatgacag      1260
     tgacctggcg ctcttcatcg cggccatcat tttgtgtgga gaccggccag gcctcatgaa      1320
     tgtgccccag gtagaagcca tccaggacac cattctgcgg gctctagaat tccatctgca      1380
     ggtcaaccac cctgacagcc agtacctctt ccccaagctg ctgcagaaga tggcagacct      1440
     gcggcagctg gtcactgagc atgcccagat gatgcagtgg ctaaagaaga cggagagtga      1500
     gaccttgctg caccccctgc tccaggaaat ctacaaggac atgtactaag gccgcagccc      1560
     aggcctcccc tcaggctctg ctgggcccag ccacggactg ttcagaggac cagccacagg      1620
     cactggcagt caagcagcta gagcctactc acaacactcc agacacgtgg cccagactct      1680
     tcccccaaca cccccacccc caccaacccc cccattcccc caacccccct cccccacccc      1740
     gctctcccca tggcccgttt cctgtttctc ctcagcacct cctgttcttg ctgtctccct      1800
     agcgcccttg ctccccccct ttgccttcct tctctagcat ccccctcctc ccagtcctca      1860
     catttgtctg attcacagca gacagcccgt tggtacgctc accagcagcc taaaagcagt      1920
     ggggcctgtg ctggcccagt cctgcctctc ctctctatcc ccttcaaaga catgagccat      1980
     ccaaagaaac actacgctct ctctgggccc agctttccaa gaagcctggc ctggaccaac      2040
     tgccatccca gcttgtggtc accaccacag ggttcctcct ccagagagca agtgggcagg      2100
     gagcctgggc cgggagccat attcccaggc tgtctcagcc ctaggcacac cactctctga      2160
     cacttccttt cttctcgccg gcgtcctagg tcattgtcac agatgaccct tgtgctgcct      2220
     aggagatgac ccctccagat gtcccctcca gatgcggtcc aacggcccca ctgaagggaa      2280
     gggggtagag gcaggccgga aggagcagcg gcacacttag gtcccagggt cagaagctag      2340
     acagcgagtg ggcaggccct ccatcagcac ccctcctcta ccctgtagca gcatccagac      2400
     tggcagatcc cagtaccagg aactggacca tagctgttct ttcttctcct gggagatgct      2460
     ggcacacctg cccccccccc ccccttgcag ctgccccggt gtagccatga cactggctca      2520
     cctctcggtc accacagagt ccctcccatt ccctccccaa ggccactggg gtacagctat      2580
     ggccctgttc ttaggactgg tgatctgtga gcaggcaggg atatcctacc aggtcacccc      2640
     tgccagctca caggcagagt tgctagggtt cctctgaccc tgtcctctct cccactcact      2700
     tgtaccagta gctctgtggc cttctcttct tttgcctggc tggtcacctg ctcccatctg      2760
     ctgcttcaag tggcttgaaa cttgctgggt gctcccatac tcagccccag cccggcagat      2820
     cctgcctcta ggcccatagg tgatcagccc aggctcggct cctgccaaca cagaatgctg      2880
     ccagattccc cgctagcaca ctccctgccc ctcacctcta ctgatcaggt cttggggtgt      2940
     tccttgtggg gcccacccag gctgagaatg gagctacatc acccgccctg cccccacctg      3000
     cccagccccg cccaggtctg gtgctgagga tgcagctcct ctcagggtct gaagtctcca      3060
     aatctgaaat gtatattttt gctaggagcc ccagcttccc gtgtttttaa tataaatagt      3120
     gtatacagac tgacggaact ttaaataaat gggaattacg tatttaagaa aaaaaaaaaa      3180
     aaaaaaaaaa a                                                           3191
//


spacer
spacer