spacer

EBI Dbfetch

ID   BC069879; SV 1; linear; mRNA; STD; MUS; 1626 BP.
XX
AC   BC069879;
XX
DT   12-MAY-2004 (Rel. 79, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus CDP-diacylglycerol synthase (phosphatidate
DE   cytidylyltransferase) 2, mRNA (cDNA clone MGC:78086 IMAGE:30439069),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1626
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1626
RA   Strausberg R.;
RT   ;
RL   Submitted (10-MAY-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; cde0056e356e1c77ad33c8e3ad9d5ee9.
DR   Ensembl-Gn; ENSMUSG00000058793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103181; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Minoru Ko
CC   cDNA Library Preparation: Yulan Piao and Minoru Ko (National
CC   Institute on Aging, NIH: http://lgsun.grc.nia.nih.gov/cDNA/)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 148 Row: o Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 20149725.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1626
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIA Mouse E6.5 Whole Embryo cDNA Library
FT                   (Long)"
FT                   /clone="MGC:78086 IMAGE:30439069"
FT                   /tissue_type="Embryo, whole"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1626
FT                   /gene="Cds2"
FT   CDS             176..1510
FT                   /codon_start=1
FT                   /gene="Cds2"
FT                   /product="Cds2 protein"
FT                   /db_xref="GOA:Q99L43"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="MGI:MGI:1332236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99L43"
FT                   /protein_id="AAH69879.1"
FT                   /translation="MTELRQRVVREDAPPEDKESESEAKLDGETASDSESRAETAPPPT
FT                   SVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKC
FT                   FHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSK
FT                   YHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMI
FT                   WFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMS
FT                   GYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIA
FT                   LSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASF
FT                   IRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILTSALEDE"
XX
SQ   Sequence 1626 BP; 369 A; 430 C; 414 G; 413 T; 0 other;
     ggattacctc ttgtcgacaa gaggtaatcc atctatgtcg ggtggtcgac aagaggtaat        60
     ccggcacggt ggggctgcga ggtgctcggg cccgccgaga gcccgtgctc actgagccga       120
     cccccgcggc caccgtgctg ctcactcggg gtgacgtcgc gccggggtcc ccagcatgac       180
     cgaactacgg cagagggttg tccgcgagga cgcacctccg gaggacaagg aatcagagtc       240
     cgaagcaaag ctagatggag agacagcgtc tgacagcgag agccgagcgg aaacagctcc       300
     cccaccaacc tccgtagatg acaccccaga ggtccttaac agggcccttt ccaacctgtc       360
     ctcaaggtgg aagaactggt gggtgagagg catcctgact ttggccatga tcgcgttttt       420
     cttcattatc atttacctgg gaccaatggt tttgatgatg attgttatgt gtgtccagat       480
     taagtgtttc catgaaataa tcactattgg ctacaatgta taccactcct acgacctgcc       540
     ctggttcagg accctcagct ggtacttcct gctgtgtgtg aactacttct tctatgggga       600
     gacagtgacg gactacttct tcactctggt ccagagagag gagcctttgc ggatcctcag       660
     taaataccac cggttcatct cctttgccct gtatctgaca ggattctgca tgtttgtact       720
     gagtctagtt aagaagcatt atcggctgca gttctacatg tttggctgga cccatgtgac       780
     cttgcttatt gtcgtaacgc agtcacacct tgttatccat aacttgtttg aaggaatgat       840
     atggtttatt gttcccatct cgtgcgtcat ctgcaatgac attatggcct atatgtttgg       900
     ctttttcttt ggtcggaccc cactcattaa gctctctcca aagaagacct gggaaggctt       960
     cattgggggc ttctttgcca ctgtggtgtt tggccttttg ctctcctatg tgatgtctgg      1020
     gtacagatgc ttcgtgtgtc ccgtggaata caacaatgac accaacagct tcactgtgga      1080
     ctgtgagccg tctgacctat tccgcctgca ggagtacaac atccctgggg tgatccagtc      1140
     ggccattggc tggaaaacgg tgaggatgta ccctttccag atccacagca tcgccctctc      1200
     caccttcgcc tcgctcatcg gccctttcgg agggttcttc gccagtggat tcaaacgggc      1260
     ctttaaaatc aaagattttg ccaataccat tcccggtcat ggaggcatca tggatcgctt      1320
     tgactgccag tacctgatgg ccacctttgt caatgtgtac atcgccagct ttatcagggg      1380
     tccaaaccca agcaaactga tccagcagtt tctgacgttg cggccagatc agcagcttca      1440
     catcttcaac acgctcaagt ctcacctaac tgacaagggg attctgacat ctgccttgga      1500
     agatgagtag agtccacctg gggcccagag agctggagca ggatggagtg ggggccagtc      1560
     gccaaggccg cccagctgct gtgacttaga taatgaaaag cttcaactca aaaaaaaaaa      1620
     aaaaaa                                                                 1626
//


spacer
spacer