spacer

EBI Dbfetch

ID   BC069873; SV 1; linear; mRNA; STD; MUS; 1670 BP.
XX
AC   BC069873;
XX
DT   12-MAY-2004 (Rel. 79, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus glycosyltransferase 8 domain containing 1, mRNA (cDNA clone
DE   MGC:78069 IMAGE:6314675), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1670
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1670
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-MAY-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000021916; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168584; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 148 Row: k Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21313215.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1670
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:78069 IMAGE:6314675"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1670
FT                   /gene="Glt8d1"
FT   CDS             154..1269
FT                   /codon_start=1
FT                   /gene="Glt8d1"
FT                   /product="glycosyltransferase 8 domain containing 1"
FT                   /db_xref="GOA:Q6NSU3"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="MGI:MGI:1923735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NSU3"
FT                   /protein_id="AAH69873.1"
FT                   /translation="MSFRKVNIIIWVLAVVLFLLVLHHNFLSLSSLLKNDISDSGIVGL
FT                   QPIDFVASAHQHPVSERQEEIPVVIAASEDRLGGTIAAINSVHQNTRSNVMFYIVTFNS
FT                   TADHLRSWLNSGSLKSIRYKIVNFDTKLLEGKVKQDPDQGESMKPLTFARFYLPILVPS
FT                   AKKAIYMDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSASTKVIIRGAGNQYNYIGYL
FT                   DYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNVTNQLEKWMKLNVEEGLYSRTLAG
FT                   SITTPPLLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHFKPWGRTA
FT                   SYADVWEKWYIPDPTGKFSLIRRHMDTSNIK"
FT   misc_difference 1586..1670
FT                   /gene="Glt8d1"
FT                   /note="polyA tail: 85 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1670 BP; 535 A; 355 C; 354 G; 426 T; 0 other;
     ggcgactgcg cccagcctcg gaaggcgacg attcgtctga cgcggctcta acctgacctg        60
     tcagtgcgtg gcgggatccc cggagcgcct caccacgtcc ccatcactcc taagcggtta       120
     atttctaatg tttgtgtaag acagaagaaa aggatgtcat tccgtaaagt gaacatcatc       180
     atctgggtcc tggctgttgt tctcttctta ctggttttgc accataactt cctcagcttg       240
     agcagtttgt taaagaatga catttcagat tcgggaattg tggggcttca gcccatagac       300
     tttgtcgcca gtgctcatca gcatccagtg agtgagaggc aagaggagat tcccgtggtt       360
     attgctgcct ctgaagacag gctgggtggg accattgcag ccataaacag cgttcatcaa       420
     aacacgcgct ccaatgtgat gttttacatt gttacattca acagcacagc agaccatctc       480
     cggtcctggc ttaacagtgg ttccttgaaa agcatcaggt acaaaattgt aaattttgac       540
     actaaacttt tggaagggaa agtaaagcag gatcctgacc agggggagtc catgaaacca       600
     ttaacctttg caaggttcta cttgccaatt ctggttccca gtgcaaagaa agccatatac       660
     atggatgatg atgtcattgt acaaggtgac atacttgcct tgtacaatac accactgaag       720
     ccaggacatg ctgctgcgtt ttcagaagat tgtgactcag cctccactaa agtcatcatc       780
     cggggagcag ggaaccagta caattacatt ggttatcttg actataaaaa ggaaagaatt       840
     cgtaaacttt ccatgaaagc cagcacctgt tcctttaatc ctggagtttt tgttgcaaac       900
     ttgactgaat ggaaaagaca gaatgtaact aaccagttgg aaaaatggat gaagctcaat       960
     gtagaagagg gattatacag cagaactctg gcaggcagca tcaccacacc tcctctgctt      1020
     atcgtatttt atcagcagca ttccaccatt gaccctatgt ggaatgtccg ccatcttggt      1080
     tccagtgctg gaaaacggta ctcaccccag tttgtaaaag ctgccaagtt acttcactgg      1140
     aatggtcact tcaagccttg gggaagaact gcttcatatg ctgatgtttg ggaaaagtgg      1200
     tatattccag acccaacagg aaaattcagt ttaatccgaa gacatatgga tacctcaaac      1260
     ataaagtgaa ctacaattta agctaattgc gtcactcagg aaactctgga agacacacta      1320
     tgtgggaagg taacagttgt agggcttgag tttctctata ccaaccacag aaaacacttc      1380
     agctgggtag aagtcataga tatccagatg actaccacgg ctccatctgc cttaccaaat      1440
     gtttgcttta ctatactgct gacttgaagg acagagaact ccagcattta actgcatcta      1500
     gctgctgtag gtaggaactg ctgtttggtt ttagttttgt accttgtggc ctggtttgta      1560
     aataaaatct acattttcca atagaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1620
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                 1670
//


spacer
spacer