spacer

EBI Dbfetch

ID   BC067063; SV 1; linear; mRNA; STD; MUS; 1866 BP.
XX
AC   BC067063;
XX
DT   08-MAR-2004 (Rel. 79, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus cathepsin C, mRNA (cDNA clone MGC:91337 IMAGE:30541061),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1866
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1866
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7827782d72534851fe71d87fecec83a5.
DR   Ensembl-Gn; ENSMUSG00000030560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032779; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31560606.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1866
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_GW0"
FT                   /clone="MGC:91337 IMAGE:30541061"
FT                   /tissue_type="Eye"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1866
FT                   /gene="Ctsc"
FT                   /note="synonyms: DPP1, DPPI"
FT   CDS             44..1432
FT                   /codon_start=1
FT                   /gene="Ctsc"
FT                   /product="cathepsin C"
FT                   /db_xref="GOA:P97821"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR014882"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="MGI:MGI:109553"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97821"
FT                   /protein_id="AAH67063.1"
FT                   /translation="MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGP
FT                   RSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAF
FT                   FKYEVRGHTAISYCHETMTGWVHDVLGRNWACFVGKKVESHIEKVNMNAAHLGGLQERY
FT                   SERLYTHNHNFVKAINTVQKSWTATAYKEYEKMSLRDLIRRSGHSQRIPRPKPAPMTDE
FT                   IQQQILNLPESWDWRNVQGVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTPI
FT                   LSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPRENCLRYY
FT                   SSDYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPF
FT                   ELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAIP
FT                   IPKL"
FT   misc_difference 1619
FT                   /gene="Ctsc"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1843..1866
FT                   /gene="Ctsc"
FT                   /note="polyA tail: 24 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1866 BP; 532 A; 407 C; 419 G; 508 T; 0 other;
     tgaacttgct ttctctgcca tctgctccgc gggcgccgtc agcatgggtc cctggaccca        60
     ctccttgcgc gccgtcctgc tgctggtgct tttgggagtc tgcaccgtgc gctccgacac       120
     tcctgccaac tgcacctacc ctgatctgct gggcacctgg gtgttccagg tgggccctag       180
     aagttcccga agcgacatta actgctcggt gatggaagca acagaagaaa aggtagtggt       240
     acaccttaag aagttggata ctgcctacga cgagctgggc aattccgggc attttaccct       300
     catttacaac caaggcttcg agattgtgtt gaatgactac aaatggtttg cgtttttcaa       360
     gtatgaagtc agaggccaca cagctatcag ttactgccat gagaccatga ctgggtgggt       420
     ccatgatgtg ctgggccgga actgggcttg ctttgttggc aagaaggtgg aaagtcacat       480
     tgagaaggtt aatatgaatg cagcacatct tggaggtctc caggaaagat attctgaaag       540
     actctacact cacaaccaca actttgtgaa ggccatcaat accgttcaga agtcttggac       600
     tgcaactgca tataaggaat atgagaaaat gagcctgcga gatctgataa ggagaagtgg       660
     ccacagccaa aggatcccaa ggcccaaacc tgccccgatg actgatgaaa tacagcaaca       720
     aattttaaat ttgccagaat cttgggactg gagaaacgtc caaggcgtca attatgttag       780
     ccctgttcga aaccaagaat cttgtggaag ctgctactca tttgcctcta tgggtatgct       840
     agaagcaaga attcgtatat taaccaacaa ttctcagaca ccaatcctga gtcctcagga       900
     ggttgtatct tgcagcccct atgcccaagg ttgtgatggt ggattcccat acctcattgc       960
     agggaagtat gcccaagatt ttggggtggt ggaagaaagc tgctttccct acacagccaa      1020
     agattctcca tgcaaaccaa gggagaattg cctccgttac tattcttctg actactacta      1080
     tgtgggtggt ttctatggtg gctgcaatga agccctgatg aagcttgagc tggtcaaaca      1140
     tggacccatg gcagttgcct ttgaagtcca cgatgacttc ctacactacc acagtggaat      1200
     ctatcaccac actgggctga gtgacccttt caaccccttc gagctgacaa atcatgctgt      1260
     tttgcttgtg ggctatggaa gagatccagt tactgggata gaatactgga ttataaagaa      1320
     cagctggggc tctaactggg gggagagtgg ctacttccgt atccgcagag gaactgatga      1380
     atgtgcaatt gagagtatag ccgtggcggc cataccgatt cctaaattat aggacatagc      1440
     tcccagtgtt acatacgggt ctttatcact cacagagtga tttagtcaca tgctgaagac      1500
     tttttcagag caatatcaga agcttaccac taagcatctt taaagaattt tgtctttgaa      1560
     cttaaaacca tccttgattt ttttctttta atatcttccc catcaactac tgaactacct      1620
     ttctttttaa agtacttggt taagtaatac ttttatgagc agtggttcag ttgtccaata      1680
     ttttttgcag gtcatctaca atgcaaccag atgtttcagt tctaaaaatc tatgtaaaag      1740
     tacaagctcg tttttaaatt atgtaagtca catgaaaaca tggcaaaaaa attagttaaa      1800
     ttttttacaa agagttttaa ataaatgttt atgtaatcag taaaaaaaaa aaaaaaaaaa      1860
     aaaaaa                                                                 1866
//


spacer
spacer