Dbfetch

ID   BC067057; SV 1; linear; mRNA; STD; MUS; 4437 BP.
XX
AC   BC067057;
XX
DT   04-MAR-2004 (Rel. 79, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus glutamate receptor, metabotropic 1, mRNA (cDNA clone MGC:91369
DE   IMAGE:30544252), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4437
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4437
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 129354c7dd945499c9d77ee0e6a56108.
DR   Ensembl-Gn; ENSMUSG00000019828; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017011; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016989; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016953; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016947; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016772; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017409; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016354; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016744; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016852; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016847; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016927; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016877; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017447; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016139; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016416; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000044306; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105561; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0024565; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0024531; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0024500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0024501; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0024311; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025011; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0023854; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0024240; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0024364; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0024364; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0024482; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0024353; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025050; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0023563; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0023867; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin,  University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328062.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4437
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_GV0"
FT                   /clone="MGC:91369 IMAGE:30544252"
FT                   /tissue_type="Brain"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4437
FT                   /gene="Grm1"
FT                   /note="synonyms: mGluR1, 4930455H15Rik"
FT   CDS             376..3096
FT                   /codon_start=1
FT                   /gene="Grm1"
FT                   /product="glutamate receptor, metabotropic 1"
FT                   /db_xref="GOA:P97772"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001256"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR019588"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97772"
FT                   /protein_id="AAH67057.1"
FT                   /translation="MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDV
FT                   IIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSE
FT                   IRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPG
FT                   SSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRY
FT                   NWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERL
FT                   PKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITI
FT                   KLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNES
FT                   LEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGYVGLCDAMKPIDGRKLLDFLIKSS
FT                   FVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKS
FT                   GMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEFTCRACDLGWWPNAELT
FT                   GCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIIL
FT                   AGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKIC
FT                   TRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGV
FT                   VAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKI
FT                   ITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNT
FT                   FLNIFRRKKPGAGNAKKRQPEFSPSSQCPSAHVQL"
FT   misc_difference 2895
FT                   /gene="Grm1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 4126^4127
FT                   /gene="Grm1"
FT                   /note="1 base in the mouse genome, G, is not found in
FT                   cDNA."
FT   misc_difference 4427..4437
FT                   /gene="Grm1"
FT                   /note="polyA tail: 11 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4437 BP; 1106 A; 1189 C; 1197 G; 945 T; 0 other;
     cgagggcggc tgcagtcctc tgacctgaga ccaatagctc tgtctacccg gactcagcgt        60
     ccagcttatg gccactaacg cgccgctcat tgcacacctg attcacacac cttcgggcac       120
     cagtgaaaaa accgcgactt gattttctgg aagaacaccc ctagggtttg ggagcggtcg       180
     tggaggacca gcaggaagaa gcggagggga gaggggcggt ggtggagact gagaagcttt       240
     gaaccagctg tgttggccaa aggcacgaag cggcaaaaga cagcggcggg cgtcagggtg       300
     gttcgcgctg ggaacctgca ggcgggaccg gcgtgggaac gtggcttgcc ggcggtcgac       360
     cgcgtcttcg ccacaatggt ccggctcctc ttgattttct tcccaatgat ctttttggag       420
     atgtccattt tgcccaggat gcctgacaga aaagtactgc tggcaggtgc ctcgtcccag       480
     cgctctgtgg cgagaatgga cggagatgtc atcatcggag ccctcttctc agtccatcac       540
     cagcctccag ccgaaaaggt accggaaagg aagtgtgggg agatcagaga acagtatggt       600
     atccagagag tggaggccat gttccacaca ttagataaga ttaatgcgga cccggtgctc       660
     ctgcccaaca tcactctggg cagtgagatc cgggactcct gctggcactc ttctgtggct       720
     ctggaacaga gcattgagtt catcagagac tccctgattt ccatccgaga tgagaaggat       780
     ggactgaacc gctgcctgcc tgatggccag accctacccc caggcaggac taagaagcct       840
     attgctggag tgatcggccc tggctccagc tctgtggcca ttcaagtcca gaatcttctg       900
     cagctgttcg acatcccaca aatcgcctat tctgccacga gcatagacct gagcgacaaa       960
     actttgtaca aatacttcct gagggtggtc ccttctgaca ctttgcaggc aagggcgatg      1020
     cttgatatcg tcaagcggta caactggacc tatgtctctg cagtccacac agaagggaat      1080
     tacggcgaga gtggaatgga tgctttcaaa gagttggctg cccaggaagg actctgcatc      1140
     gcacactcgg acaaaatcta cagcaatgct ggcgagaaga gctttgatcg gcttctgcgc      1200
     aagctccgag agcggcttcc caaggccagg gttgtggtct gcttctgcga gggcatgaca      1260
     gtgcgggggt tactgagtgc catgcgccgc cttggcgtcg tgggagagtt ctcactcatt      1320
     ggaagtgatg gatgggcaga cagagatgaa gtcatcgaag gctatgaggt ggaagccaat      1380
     gggggaatca caataaagct gcagtctcca gaggtcaggt cgtttgatga ctactttctg      1440
     aagctgaggc tggacaccaa cacgaggaat ccttggttcc ctgagttctg gcaacatcgc      1500
     ttccagtgtc gcctacctgg acacctcttg gaaaacccca actttaaaaa agtctgcaca      1560
     ggaaatgaaa gcttggaaga aaattatgtc caggacagca aaatgggatt tgtcatcaac      1620
     gccatctatg ccatggcaca cggcctacag aacatgcacc atgctctatg tcctggctac      1680
     gtgggccttt gtgatgccat gaagcccatt gacggcagga agctcctgga tttcctcatc      1740
     aaatcctctt ttgttggagt gtctggagag gaggtctggt tcgatgagaa gggggatgca      1800
     cctggaaggt atgacattat gaatctgcag tacacagagg ctaatcgcta tgactatgtc      1860
     catgtgggaa cctggcatga aggtgtgctg aatatcgatg attacaaaat ccagatgaac      1920
     aaaagcggaa tggtacgatc tgtgtgcagc gagccttgct taaagggtca gattaaggtc      1980
     atacggaaag gggaagtgag ctgctgctgg atctgcacag cctgcaaaga gaatgagttt      2040
     gtgcaagatg agtttacctg cagagcctgt gacctggggt ggtggcccaa tgcagagctc      2100
     acaggctgtg agcccattac tatccgttac ctcgagtgga gtgacataga atccatcata      2160
     gccatcgcct tttcttgcct gggcatcctc gtgacgctat ttgtcaccct catctttgtg      2220
     ctgtaccggg acacacctgt ggtcaaatcc tccagtagag agctctgcta tatcattctg      2280
     gctggtattt tcctcggcta cgtatgccct ttcaccctca tcgccaaacc tactaccaca      2340
     tcctgctacc tccagcgcct cctagttggc ctctcttctg ccatgtgcta ctctgctctt      2400
     gtgaccaaaa ccaatcgtat tgcacgcatc ctggctggca gcaagaagaa gatctgtacc      2460
     cggaagccca ggttcatgag cgcttgggcc caagtgatca tagcctccat tctgattagt      2520
     gtacagctga cactagtggt gaccttgatc atcatggagc ctcccatgcc cattttgtcc      2580
     tacccgagca tcaaggaagt ctatcttatc tgcaatacca gcaacctggg tgtagtggca      2640
     cctgtgggtt acaacggact tctcatcatg agctgtacct actatgcctt caagacccgc      2700
     aacgtgccgg ccaatttcaa tgaggctaaa tacatcgcct tcactatgta caccacctgc      2760
     atcatctggc tggcttttgt tcccatttac tttgggagca actacaagat tatcactacc      2820
     tgcttcgcag tgagcctcag tgtgacggtg gccctgggct gcatgttcac tcccaagatg      2880
     tacatcatta ttgctaaacc cgagaggaat gtccgcagtg ccttcaccac ctctgatgta      2940
     gtgcgcatgc acgtcggtga cggcaagctg ccatgccgct ccaacacctt cctcaacatt      3000
     ttccggagaa agaagcctgg ggcagggaac gccaagaaga ggcagccaga attctcgccc      3060
     agcagccagt gtccgtcggc acatgtgcag ctttgaaaac ccccacactg cagtgaatgt      3120
     ttctaacggc aagtctgtgt catggtctga accaggtgga agacaggcgc ccaagggaca      3180
     gcatgtgtgg cagcgcctct ctgtgcacgt gaagaccaat gagacggcct gtaaccaaac      3240
     agccgtaatt aaacccctca ctaaaagtta ccaaggctct ggcaagagtc tgaccttttc      3300
     agacgccagc accaagaccc tttacaacgt ggaggaagag gacaataccc cttcaactca      3360
     cttcagccct cccagcagcc cttccatggt ggtgcaccga cgcgggccac ccgtggccac      3420
     cacgccacct ctgccacccc accttagcgc agaagagacg cccttgttcc tggctgattc      3480
     tgtcatcccc aagggcttgc ctcctcctct cccgcagcag caacagcagc cgccccctca      3540
     gccgcctccg cagcagccca aatccctgat ggaccagctg caaggcgtgg tcaccaactt      3600
     tggctctggg attccagact tccacgcggt gctggcaggc ccggggacac cagggaacgg      3660
     gctgcgctcc ctgtacccgc ccccgcctcc accgcaacac ctgcagatgt tgcccctgca      3720
     gctgagcacc ttccgagagg agcccatctc ccctccgggg gaggacgacg atgatgacag      3780
     cagcgagagg ttcaagctcc tgcaggagtt cgtgtatgag cgtgaaggga acacggagga      3840
     agacgatctg gaagaggagg aggacctgcc tgcagccagc aagctgacgc ctgaggattc      3900
     gcctgccctg acgccccctt ctcctttccg agattccgtg gcctctggca gctcagtgcc      3960
     cagttcccca gtgtctgagt cagtgctctg cacccctcca aatgtgacct atgcctctgt      4020
     cattctgagg gactacaagc aaagctcttc cactctgtag taagggggga gtatgcgtgg      4080
     agaagccaga gatgccaagg agtgtcaacc ctttcagaaa tgtgtaaaag caagggggtg      4140
     gggtgggatg gaggaccaca gtctgcaggg aagaaaaaaa agaaaagaaa aggaaaggaa      4200
     aggaaaggaa aggaaaggaa aggaaaggaa aggaaaggaa aggaaaggaa aggaaaggaa      4260
     aggaaaaaag atgcggctgc cttaaagagg gagagggaag atgccaactg aacagtggtc      4320
     ccggccagga ctgtgactct tgaattattc aaaaaccttc tctagaaaga aagggaatta      4380
     tgacaaagca caattccata tggtatgtaa cttttatcga aaaaaaaaaa aaaaaaa         4437
//