Dbfetch

ID   BC067003; SV 1; linear; mRNA; STD; MUS; 3149 BP.
XX
AC   BC067003;
XX
DT   08-MAR-2004 (Rel. 79, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus transient receptor potential cation channel, subfamily C,
DE   member 2, mRNA (cDNA clone IMAGE:6402564), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3149
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3149
RA   Strausberg R.;
RT   ;
RL   Submitted (01-MAR-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; f58c19ea74b2d893f82be602821afd45.
DR   EuropePMC; PMC3170594; 21854574.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3149
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FC0"
FT                   /clone="IMAGE:6402564"
FT                   /tissue_type="Mouse, brain 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..3149
FT                   /gene="Trpc2"
FT                   /note="synonyms: TRPC2a, TRPC2b, trp2, mTrp2"
FT   CDS             701..1642
FT                   /codon_start=1
FT                   /gene="Trpc2"
FT                   /product="Trpc2 protein"
FT                   /db_xref="GOA:Q8BRU2"
FT                   /db_xref="InterPro:IPR002706"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BRU2"
FT                   /protein_id="AAH67003.1"
FT                   /translation="MLMSRTDSKSGKNRSGVRMFKDGDFLTPASGESWDRLRLTCSQPF
FT                   TRHQSFGLAFLRVRSSLGSLADPVVDPSAPGSSGLNQNSTDVLESDPRPWLTNPSIRRT
FT                   FFPDPQTSTKEISELKGMLKQLQPGPLGRAARMVLSAARKAPPASVVSPNNSHGEPGPS
FT                   RAESAEPRAEEPNRKTAVGRRKRRKVQEPRRSLSNSSSQPNRRTGRTRQRQHRPQTKSD
FT                   DGGVQAAGQCPICAGFFSIETLPQHAATCGESPPPQPASPASLSSSESVLWVSSPESSP
FT                   PPSWVQCPICELQFSAREIEEHASVCGEVLPA"
XX
SQ   Sequence 3149 BP; 794 A; 774 C; 840 G; 741 T; 0 other;
     cggaaattta agtcccactc gctaagggcg gactggagcg tgtaaaaaaa aaagaaaaaa        60
     tatatatata cacgcacgcg gggttttgtt attttgtttt tagatgtagt aactgctgta       120
     tttcctcttg gaagtcgtct ttcagaaaaa gcggctcccg taggactcaa aacccgttcc       180
     tacagtagaa aggcttgggg ccagaaggcg gaggtcacgg aacggaattg gcgggagaat       240
     aagatccgga gctccggagc tgaggctacc acgacgtaaa gtttacgaac tcgggagtaa       300
     tataaagatt cttgttctcc caaaagctac caagagcaaa acatcaacag taccaccgtg       360
     gctacagaag acatcggggg aggaagcgtg tcttcctcgc acttaaggaa gctggtggcg       420
     tccgatggct cctgtgaaga tcagccatgt ggtgtcattt tcctctcagg atcccaaata       480
     tcctgtggag aacttgctga acccagacag tcacagggga ccctggctca gctgccctca       540
     ggacaagact ggacaactga aagtggagtt tcagctggag agggcagtgc ccataagcta       600
     tattgatgtt ggaaactgtg gctgtgcttt cctacagatt gatgtgggtc gttcttcctg       660
     gcccctggac agacctttcg tcaccctgct ccctgccacc atgctaatgt cccgcactga       720
     ctccaagtcg gggaagaacc gctcaggggt ccggatgttt aaagatggtg atttcctgac       780
     tccagcctca ggagagtcct gggatcgact tcgattgacc tgctcccaac ctttcacacg       840
     tcatcagtcc tttggcctgg ccttcctacg agtgcgttcc tctctgggct ctctggctga       900
     ccctgtagta gatccctcag cccctgggag ctctgggctt aaccagaact ctacagatgt       960
     gctggagtct gatcctaggc cctggctgac taatccttct atccggagga cattcttccc      1020
     cgatccccag acgagcacca aggaaatttc agagctcaag ggtatgttga agcagttgca      1080
     gccagggcct ctggggcggg cagcccgcat ggtgctttct gctgcccgta aggcccctcc      1140
     agccagtgtg gtaagcccaa acaacagcca cggagaacca ggtcccagcc gtgcagagag      1200
     tgcagagccc agagcagaag aaccaaacag gaagacggct gtgggcagaa ggaagaggag      1260
     gaaagtgcag gagccaagga gatcgttgtc caactcgagt tctcagccaa ataggaggac      1320
     aggaaggaca agacaaagac agcaccgacc tcagaccaaa agtgatgacg gtggtgtgca      1380
     ggctgctgga cagtgtccta tttgtgcagg tttcttcagt attgagactc ttccccagca      1440
     tgctgcaact tgtggagaga gccccccacc ccagccagct tctcctgcct ccttgtcttc      1500
     ctcggagtcc gtgctgtggg tctcctcccc agagagctcg ccgccacctt cctgggtcca      1560
     gtgccctatc tgtgaattac agttctcagc aagagaaata gaagaacatg ccagcgtgtg      1620
     tggggaagtt ttgccagcct gagcagtgac gttctgttga ccctttatgt tggagcctgg      1680
     ggaatggatc tctggtggct aagaagggtt gggtcccctc cctccagcta ttactcagga      1740
     ctccgcctgc ctgagaacac tgtggaccca gcttgctccc cattcctgtt gtcaaggctt      1800
     tgtcactatg gtacccaatt ctcaaaggat attttcccct tagaacttct ttggtagaat      1860
     tgatgatctc tccaaggcct taggatacta tctagaatgt gttacctaat gcccattttc      1920
     ctgaatgaaa aactgaggct cagtcagggg gaaataatgg ctgggaatta taaagttatg      1980
     ctgtttggga agatgagtga atgagtcttg agtgtgaaac taacgagttc catatgacct      2040
     tgaccttctg tgttcttcat gggtatctgt ctcagatgta gtcagatgac tctgaaactt      2100
     tacttctcat gggtgtgaaa tggatcttca gtaacatgaa aaccctcttc ctactcacat      2160
     ggttcttaag ggagccagag agattccttt ctaaggagta gatgattctg ggcatggctt      2220
     gtaagggttt gagcaaatct cattccaact atttgagata gttggaccac agtgtctccc      2280
     ctggagctgt ggtagttcaa ttctgcttta aagaattgtg cacgcttccc tttttcccca      2340
     ggagacgtca tcatgtggca ctaacacccg ttccccttgt ccccaaggta cgaggcaggg      2400
     agagagcagc tggtcctgat gaagggaggg cacagggtgg ggctttgggt agaaataaaa      2460
     gagaatgcta ggcacagtca agggagaggc agagctggag ttcaagcatt cagcccctgc      2520
     ccacagaggt gggtgcagcc atggaccccc tttcggtaag agacccctgc tttcctcccc      2580
     tcttcatccc agtccccggg gatgcaggga cagcctgctg ccagacaagt ctgggatgct      2640
     gctgctggtg ggagagccct cggatccctg atccagggcc tagaagaaaa gagcaaaggg      2700
     ctgggcctgg tagaagaaca ggaccaaaca ctaaggagta gagatgctcc ccaaagtaga      2760
     agacagattg agagcgggtg gtggaaggga acatcttaag gtcctgctag agccctctgc      2820
     atagacaaag ggtttaggga aagcccagct tgaagaccct ccatgtgtgc gtgtctgaac      2880
     ttgtccttca gagagagaaa cagctagaag atcaagcaag ctgggatcct attcttgcca      2940
     gattctgtgt gcttgtgtgt aggttaggta cctagtgtgg ccccgaccac ctactctaat      3000
     cacctcttca gggaactgac actgggccct gctacgtggg attttttata agagtggaag      3060
     tgagcagagt aaacactccc cacactagcg tttcctaagt gaatctacat aataaaatgg      3120
     tgaacaagac aaaaaaaaaa aaaaaaaaa                                        3149
//