spacer

EBI Dbfetch

ID   BC066840; SV 1; linear; mRNA; STD; MUS; 3556 BP.
XX
AC   BC066840;
XX
DT   08-MAR-2004 (Rel. 79, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus membrane metallo endopeptidase, mRNA (cDNA clone
DE   IMAGE:30465845), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3556
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3556
RA   Strausberg R.;
RT   ;
RL   Submitted (01-MAR-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; e3ff5463b9915c67b8e1d526ea38307b.
DR   Ensembl-Gn; ENSMUSG00000027820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029400; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Mark G.Carter (NIH/NIA-IRP)
CC   cDNA Library Preparation: Yulan Piao and Minoru Ko (National
CC   Institute on Aging, NIH: http://lgsun.grc.nia.nih.gov/cDNA/)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 144 Row: n Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 11496250.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3556
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIA Mouse Embryonic Germ Cell cDNA Library
FT                   (Long)"
FT                   /clone="IMAGE:30465845"
FT                   /tissue_type="Embryonic Germ Cell, mouse, day 8.0"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..3556
FT                   /gene="Mme"
FT                   /note="synonyms: NEP, CD10, CALLA, 6030454K05Rik"
FT   CDS             <1..2250
FT                   /codon_start=1
FT                   /gene="Mme"
FT                   /product="Mme protein"
FT                   /db_xref="GOA:Q61391"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:97004"
FT                   /db_xref="PDB:2YVC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61391"
FT                   /protein_id="AAH66840.1"
FT                   /translation="GRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMI
FT                   ALYATYDDGICKSSDCIKSAARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRYS
FT                   NFDILRDELEVILKDVLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLKLLPDI
FT                   YGWPVASDNWDQTYGTSWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQPR
FT                   LGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEQSLPIDENQLSLEMNKVMELEKE
FT                   IANATTKPEDRNDPMLLYNKMTLAKLQNNFSLEVNGKSFSWSNFTNEIMSTVNINIQNE
FT                   EEVVVYAPEYLTKLKPILTKYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYG
FT                   TTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLT
FT                   WMDAETKKKAEEKALAIKERIGYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKFS
FT                   QSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGG
FT                   IGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAGG
FT                   QHLNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWC
FT                   GTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW"
FT   misc_feature    232..1446
FT                   /gene="Mme"
FT                   /note="Peptidase_M13_N; Region: Peptidase family M13. M13
FT                   peptidases are well-studied proteases found in a wide range
FT                   of organisms including mammals and bacteria. In mammals
FT                   they participate in processes such as cardiovascular
FT                   development, blood-pressure regulation, nervous control of
FT                   respiration, and regulation of the function of
FT                   neuropeptides in the central nervous system. In bacteria
FT                   they may be used for digestion of milk"
FT   misc_feature    1624..2244
FT                   /gene="Mme"
FT                   /note="Peptidase_M13; Region: Peptidase family M13.
FT                   Mammalian enzymes are typically type-II membrane anchored
FT                   enzymes which are known, or believed to activate or
FT                   inactivate oligopeptide (pro)-hormones such as opioid
FT                   peptides. The family also contains a bacterial member
FT                   believed to be involved with milk protein cleavage"
XX
SQ   Sequence 3556 BP; 1119 A; 710 C; 738 G; 989 T; 0 other;
     ggaagatcag aaagtcagat ggatataact gatatcaatg ctccaaagcc aaagaagaaa        60
     cagcgatgga ctcccctgga gatcagcctc tctgtgcttg tcttgctcct gactatcata       120
     gcggtgacaa tgatcgctct ctatgcaacc tatgatgatg gcatttgcaa atcatcagac       180
     tgcataaaat cagctgctcg actgattcag aatatggatg cctctgttga gccatgtaca       240
     gacttcttca agtatgcttg tggaggctgg ttgaaacgca acgtcattcc cgagaccagt       300
     tcccgataca gtaattttga cattttaaga gatgagctag aagtcatttt gaaagatgtc       360
     cttcaagaac ccaaaactga ggacatagta gcagtgcaga aagcaaaaac cttgtacaga       420
     tcgtgtataa atgagtctgc tattgatagc agaggcggac aacctctact caaactgtta       480
     ccagatatat atgggtggcc agtagcatca gataactggg atcaaacata tggcacttct       540
     tggacagctg agaaatccat tgcacaactg aattctaaat atgggaaaaa ggtcctcatt       600
     aatttttttg ttggcactga tgataagaat tctacccagc atataattca ttttgaccag       660
     cctcgacttg gcctcccttc cagagactac tatgagtgca ctggaatata taaagaggct       720
     tgcacagcat atgtggattt tatgatttct gtggccagac tgattcgtca ggaacaaagt       780
     ttgcctattg atgaaaacca gctctctttg gaaatgaata aagttatgga attggaaaaa       840
     gaaattgcca atgctacaac taaaccagaa gaccgaaatg acccaatgct gctttataac       900
     aaaatgacat tggccaagct gcagaacaac ttttccctgg aggtcaatgg gaagtcattc       960
     agctggtcaa atttcacaaa tgaaatcatg tcaactgtga atattaatat tcaaaatgag      1020
     gaagaagttg ttgtctatgc tccagaatat ttaaccaaac ttaagcctat tcttaccaaa      1080
     tattctccca gagatcttca aaatttaatg tcctggaggt tcataatgga tcttgtaagc      1140
     agcctcagcc gaaattacaa ggagtccaga aatgctttcc gcaaggccct ttatgggact      1200
     acatcagaaa ctgcaacatg gagacggtgt gctaactacg tcaatgggaa tatggagaat      1260
     gctgtgggga ggctttatgt ggaagcggct tttgctggag agagcaagca cgtggttgaa      1320
     gacttgattg cacaaatccg ggaagttttt attcagactt tggatgacct tacttggatg      1380
     gatgctgaga caaaaaagaa agctgaagaa aaggccttgg caattaaaga aaggattggc      1440
     tatcctgatg acatcatttc caatgagaac aaactgaata atgagtatct tgagttgaac      1500
     tacagggaag atgaatactt tgagaacata attcaaaatt tgaaattcag ccaaagcaag      1560
     cagctaaaga agctccgaga aaaagtggac aaagatgagt ggataagtgg agcagctgta      1620
     gtcaatgcat tttattcctc aggccgaaat cagatagtct tccccgctgg cattttgcag      1680
     cccccattct tcagtgctca gcaatccaac tcattgaact atgggggcat cggcatggtc      1740
     attggacatg aaatcacaca tggatttgat gacaatggaa gaaatttcaa taaagatgga      1800
     gacctcgttg actggtggac gcagcagtcg gcaaataatt ttaaagacca atcccagtgt      1860
     atggtatacc agtatggaaa cttttcctgg gacctagcag gtggacagca tctcaatgga      1920
     attaatacac taggagaaaa cattgctgat aatggaggta ttggccaagc atacagagcc      1980
     tatcagaatt atgttaaaaa gaatggtgaa gaaaaattac tccctggact tgacctcaat      2040
     cacaaacaac tatttttcct gaactttgcc caggtgtggt gtgggaccta ccggccagag      2100
     tatgcagtca attctattaa aacagatgta cacagtcctg gaaatttcag gatcattggg      2160
     actttgcaga actctgccga gtttgcagat gcctttcatt gccgcaagaa ttcatacatg      2220
     aatccagaaa ggaaatgtcg ggtttggtga tcttcacaag atactgaaca tccacggcaa      2280
     gatttgccaa agccacggaa acaggaactc ttccctcaga gaaactgggc cccggaagtt      2340
     tcttcagctt cctggggggc aattcacaga gacgagcatg agctaacata aatgaaatta      2400
     gattattaaa tctgctgtga atgaaagggg agggagccta cgatctagca aatcaatcac      2460
     ttcactgtgt aaataatgat tactttccaa cggtagtact accgttcact tctgtttctc      2520
     acacagactg cagctttcat gttgtctgta gagaacagtg ttaacactta aagcagacta      2580
     tgacttctga tcaaaaggag gacgatgctc agtacagcag ggcaccaaag cacagatttg      2640
     cccctcagca ctcacttttg tttgcaacat tcatgctcct tccaaactct cccaaagaac      2700
     tcccatacag actgtggcct tcaggctcgt gcagttttga actcatttta ccatacataa      2760
     gttattcatt catcccacat caatttagtt tgaacactct tagagcttaa actagagtat      2820
     ctgaaacggt tcccctattt cacccacttt agtgatgttg agattcttga acccccctgc      2880
     agatctttga gcaatttctt gctcttgctg cccctcagac tcagtctttt aaaggatttg      2940
     tagtaatgta taaagaataa ttctatattt aattattaac tacatttatg actgaataaa      3000
     ccattgctat aggtaatcat tgaatattga agttatatgg ccaagatagt tttgaagatc      3060
     tgtaacatga tatacagacg aaaatttgag actctttaaa tctgtaaatc atattgatga      3120
     aaagctttaa gtacaaactc tgggggtgag cattaccatt ggacgggtgt cttgagatac      3180
     ataatagttg tggtttacaa acagcatttt caagattaag tctgtcccta gtggctaaga      3240
     aagggtctaa ctgtatctgt gttgctccat gaatgcttag ccttcaggtt tgtcatcaga      3300
     tgaaaatatt ttgataataa attgacgttg tgagcccctt actaggcctg tgtgcacgcc      3360
     atgccaccta gctttagaaa gcctatgtct gaatcgagat gggcagcctc cactgtacct      3420
     gcttcttgaa ttctacagct catggactct aattggattt cctgaggcac tcatatgcct      3480
     tccttgtcct tctgcttact ttagtgattt tcactattca gtataaattt tacaaagatt      3540
     caaaaaaaaa aaaaaa                                                      3556
//


spacer
spacer