spacer

EBI Dbfetch

ID   BC066206; SV 1; linear; mRNA; STD; MUS; 2021 BP.
XX
AC   BC066206;
XX
DT   19-FEB-2004 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus alpha fetoprotein, mRNA (cDNA clone MGC:76732 IMAGE:30469872),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2021
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2021
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-FEB-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0074ded69a94d2858f3dcfec1a363747.
DR   Ensembl-Gn; ENSMUSG00000054932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042755; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Minoru Ko
CC   cDNA Library Preparation: Yulan Piao and Minoru Ko (National
CC   Institute on Aging, NIH: http://lgsun.grc.nia.nih.gov/cDNA/)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 144 Row: o Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982512.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2021
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIA Mouse Newborn Kidney cDNA Library (Long 1)"
FT                   /clone="MGC:76732 IMAGE:30469872"
FT                   /tissue_type="Kidney, newborn mouse, C57BL/6J"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2021
FT                   /gene="Afp"
FT   CDS             31..1848
FT                   /codon_start=1
FT                   /gene="Afp"
FT                   /product="alpha fetoprotein"
FT                   /db_xref="GOA:P02772"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR001703"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87951"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02772"
FT                   /protein_id="AAH66206.1"
FT                   /translation="MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLS
FT                   IATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESQLSVFLDEICHETELSNKY
FT                   GLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRFIYEVS
FT                   RRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNEHVCSV
FT                   IRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQDGEKVM
FT                   TYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNFAQFSS
FT                   EEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNLEEELQK
FT                   HIEESQALSKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCC
FT                   QLSEEKWSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFLRDETY
FT                   APPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLE
FT                   KCCKAQDQEVCFTEEGPKLISKTRDALGV"
FT   misc_difference 1997..2021
FT                   /gene="Afp"
FT                   /note="polyA tail: 25 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2021 BP; 611 A; 459 C; 473 G; 478 T; 0 other;
     gcactgcctg cggtgaagga accagcagcc atgaagtgga tcacacccgc ttccctcatc        60
     ctcctgctac atttcgctgc gtccaaagca ttgcacgaaa atgagtttgg gatagcttcc       120
     acgttagatt cctcccagtg cgtgacggag aagaatgtgc ttagcatagc taccatcacc       180
     tttacccagt ttgttccgga agccaccgag gaggaagtga acaaaatgac tagcgatgtg       240
     ttggctgcaa tgaagaaaaa ctctggcgat gggtgtttag aaagccagct atctgtgttt       300
     ctggatgaaa tttgtcatga gacggaactc tctaacaagt atggactctc aggctgctgc       360
     agccaaagtg gagtggaaag acatcagtgt ctgctggcac gcaagaagac tgctccggcc       420
     tctgtcccac ccttccagtt tccagaacct gccgagagtt gcaaagcaca tgaagaaaac       480
     agggcagtgt tcatgaacag gttcatctat gaagtgtcaa ggaggaaccc cttcatgtat       540
     gccccagcca ttctgtcctt ggctgctcag tacgacaagg tcgttctggc atgctgcaaa       600
     gctgacaaca aggaggagtg cttccagaca aagagagcat ccattgcaaa ggaattaaga       660
     gaaggaagca tgttaaatga gcatgtatgt tcagtgataa gaaaatttgg atcccgaaac       720
     ctccaggcaa caaccattat taagctaagt caaaagttaa ctgaagcaaa ttttactgag       780
     attcagaagc tggccctgga tgtggctcac atccacgagg agtgttgcca aggaaactcg       840
     ctggagtgtc tgcaggatgg ggaaaaagtc atgacatata tatgttctca acaaaatatt       900
     ctgtcaagca aaatagcaga gtgctgcaaa ttacccatga tccaactagg cttctgcata       960
     attcacgcag agaatggcgt caaacctgaa ggcttatctc taaatccaag ccagtttttg      1020
     ggagacagaa attttgccca attttcttca gaggaaaaaa tcatgttcat ggcaagcttt      1080
     cttcatgaat actcaagaac tcaccccaac cttcctgtct cagtcattct aagaattgct      1140
     aaaacgtacc aggaaatatt ggagaagtgt tcccagtctg gaaatctacc tggatgtcag      1200
     gacaatctgg aagaagaatt gcagaaacac atcgaggaga gccaggcact gtccaagcaa      1260
     agctgcgctc tctaccagac cttaggagac tacaaattac aaaatctgtt ccttattggt      1320
     tacacgagga aagcccctca gctgacctca gcagagctga tcgacctcac cgggaagatg      1380
     gtgagcattg cctccacgtg ctgccagctc agcgaggaga aatggtccgg ctgtggtgag      1440
     ggaatggccg acattttcat tggacatttg tgtataagga atgaagcaag ccctgtgaac      1500
     tctggtatca gccactgctg caactcttcg tattccaaca ggaggctatg catcaccagt      1560
     tttctgaggg atgaaaccta tgcccctccc ccattctctg aggataaatt catcttccac      1620
     aaggatctgt gccaagctca gggcaaagcc ctacagacca tgaaacaaga gcttctcatt      1680
     aacctggtga agcaaaagcc tgaactgaca gaggagcagc tggcggctgt cactgcagat      1740
     ttctcgggcc ttttggagaa gtgctgcaaa gcccaggacc aggaagtctg tttcacagaa      1800
     gagggtccaa agttgatttc caaaactcgt gatgctttgg gcgtttaaac atctccagaa      1860
     ggaagagtgg acaaaaaaat gtgttgactc tttggtgtga gccttttggc ttaactgtaa      1920
     ctgctagtac tttaaccaca tggtgaagat gtccatgtga gatttctata ccttaggaat      1980
     aaaaactttt caactaaaaa aaaaaaaaaa aaaaaaaaaa a                          2021
//


spacer
spacer