spacer

EBI Dbfetch

ID   BC066019; SV 1; linear; mRNA; STD; MUS; 2045 BP.
XX
AC   BC066019;
XX
DT   04-FEB-2004 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus cysteine rich protein 61, mRNA (cDNA clone MGC:90137
DE   IMAGE:5716887), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2045
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2045
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-FEB-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a26999aafe2b6ac7ffea96d4b1d97b01.
DR   Ensembl-Gn; ENSMUSG00000028195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029846; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6753593.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2045
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FD0"
FT                   /clone="MGC:90137 IMAGE:5716887"
FT                   /tissue_type="Brain, mouse 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2045
FT                   /gene="Cyr61"
FT                   /note="synonyms: Igfbp10, CCN1"
FT   CDS             174..1313
FT                   /codon_start=1
FT                   /gene="Cyr61"
FT                   /product="cysteine rich protein 61"
FT                   /db_xref="GOA:P18406"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001007"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR006208"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR012395"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="MGI:MGI:88613"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18406"
FT                   /protein_id="AAH66019.1"
FT                   /translation="MSSSTFRTLAVAVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGL
FT                   VRDGCGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNS
FT                   RIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVSGQCCEEWVC
FT                   DEDSIKDSLDDQDDLLGLDASEVELTRNNELIAIGKGSSLKRLPVFGTEPRVLFNPLHA
FT                   HGQKCIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKG
FT                   KKCSKTKKSPEPVRFTYAGCSSVKKYRPKYCGSCVDGRCCTPLQTRTVKMRFRCEDGEM
FT                   FSKNVMMIQSCKCNYNCPHPNEASFRLYSLFNDIHKFRD"
FT   misc_difference 1663
FT                   /gene="Cyr61"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 2005..2045
FT                   /gene="Cyr61"
FT                   /note="polyA tail: 41 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2045 BP; 535 A; 535 C; 521 G; 454 T; 0 other;
     cgccccagag aagcgcctgc aatctctgcg cctcctccgc cagcacctcg agagaaggac        60
     acccgccgcc tcggccctcg cctcaccgca ctccgggcgc atttgatccc gctgctcgcc       120
     ggcttgttgg ttctgtgtcg ccgcgctcgc cccggttcct cctgcgcgcc acaatgagct       180
     ccagcacctt caggacgctc gctgtcgccg tcacccttct ccacttgacc agactggcgc       240
     tctccacctg ccccgccgcc tgccactgcc ctctggaggc acccaagtgc gccccgggag       300
     tcgggttggt ccgggacggc tgcggctgct gtaaggtctg cgctaaacaa ctcaacgagg       360
     actgcagcaa aactcagccc tgcgaccaca ccaaggggtt ggaatgcaat ttcggcgcca       420
     gctccaccgc tctgaaaggg atctgcagag ctcagtcaga aggcagaccc tgtgaatata       480
     actccagaat ctaccaaaac ggggaaagct tccagcccaa ctgtaaacac cagtgcacat       540
     gtattgatgg cgccgtgggc tgcattcctc tgtgtcccca agaactgtct ctccccaatc       600
     tgggctgtcc caacccccgg ctggtgaaag tcagcgggca gtgctgtgaa gagtgggttt       660
     gtgatgaaga cagcattaag gactccctgg acgaccagga tgacctcctc ggactcgatg       720
     cctcggaggt ggagttaacg agaaacaatg agttaatcgc aattggaaaa ggcagctcac       780
     tgaagaggct tcctgtcttt ggcaccgaac cgcgagttct tttcaaccct ctgcacgccc       840
     atggccagaa atgcatcgtt cagaccacgt cttggtccca gtgctccaag agctgcggaa       900
     ctggcatctc cacacgagtt accaatgaca acccagagtg ccgcctggtg aaagagaccc       960
     ggatctgtga agtgcgtcct tgtggacaac cagtgtacag cagcctaaaa aagggcaaga      1020
     aatgcagcaa gaccaagaaa tccccagaac cagtcagatt tacttatgca ggatgctcca      1080
     gtgtcaagaa ataccggccc aaatactgcg gctcctgcgt agatggccgg tgctgcacac      1140
     ctctgcagac cagaactgtg aagatgcggt tccgatgcga agatggagag atgttttcca      1200
     agaatgtcat gatgatccag tcctgcaaat gtaactacaa ctgcccgcat cccaacgagg      1260
     catcgttccg actgtacagc ctattcaatg acatccacaa gttcagggac taagtgcctc      1320
     cagggttcct agtgtgggct ggacagagga gaagcgcaag catcatggag acgtgggtgg      1380
     gcggaggatg aatggtgcct tgctcattct tgagtagcat tagggtattt caaaactgcc      1440
     aaggggctga tgtggacgga cagcagcgca gccgcagttg gagaatgcca aggggctgat      1500
     gtggacggac agcagcgcag ccgcagttgg agaagacttc gcttcatagt actggagcgg      1560
     gcattattgc tccatattgg agcatgttta cggatgacgt tctgttttct gtttgtaaat      1620
     tatttgctaa gtgtattttt ttgctccaga cccccccccc ccctttcttg gttctacaat      1680
     tgtaatagag acaaaataag attagttggg ccaagtgaaa gccctgcttg tcctttgaca      1740
     gaagtaaatg aaagcgcctc tcattccttc ccgagcggag gggggacact ctgtgagtgt      1800
     ccttggggca gctacctgca ctctaaaact gcaaacagaa accaggtgtt ttaagattga      1860
     atgttttttt atttatcaaa gtgtagcttt tggggaggga ggggaaatgt aatactggaa      1920
     taatttgtaa atgattttaa ttttatatca gtgaagagaa tttatttata aaattaatca      1980
     tttaataaag aaatatttac ctaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2040
     aaaaa                                                                  2045
//


spacer
spacer