spacer

EBI Dbfetch

ID   BC064109; SV 1; linear; mRNA; STD; MUS; 1489 BP.
XX
AC   BC064109;
XX
DT   13-DEC-2003 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus adiponectin receptor 2, mRNA (cDNA clone MGC:73838
DE   IMAGE:3371697), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1489
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1489
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (11-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cdae9ed098b7fae140bef90c05ff32d8.
DR   Ensembl-Gn; ENSMUSG00000030168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169744; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Marcello Bento  Soares, Ph.D.
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 138 Row: l Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 39841015.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1489
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Soares_mammary_gland_NMLMG"
FT                   /clone="MGC:73838 IMAGE:3371697"
FT                   /tissue_type="Mammary gland, lactating mouse"
FT                   /note="Vector: pT7T3-Pac"
FT                   /db_xref="taxon:10090"
FT   gene            1..1489
FT                   /gene="Adipor2"
FT                   /note="synonyms: Paqr2, ADCR2"
FT   CDS             151..1311
FT                   /codon_start=1
FT                   /gene="Adipor2"
FT                   /product="adiponectin receptor 2"
FT                   /db_xref="GOA:Q8BQS5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:93830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BQS5"
FT                   /protein_id="AAH64109.1"
FT                   /translation="MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPS
FT                   LETPVCSSYYENSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWR
FT                   VIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLG
FT                   IFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSG
FT                   IALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGV
FT                   FVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGK
FT                   CDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCTEEDAL"
FT   misc_difference 1472..1489
FT                   /gene="Adipor2"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1489 BP; 350 A; 372 C; 363 G; 404 T; 0 other;
     caagaatccg tggagctcag cagtaccctc agactctggt ctacaactct gacaggattt        60
     ggggtcaact taccatccct taaaaatcca ttctcccaag aagaagggac agaaagaaag       120
     accactttgt aagaaaggct ttggtatccc atgaacgagc cagccaaaca ccgattgggg       180
     tgcaccagga ctccagagcc agatatacgg ctcagaaaag ggcaccaact tgatgataca       240
     aggggaagta ataatgacaa ctaccaagga gatttggagc ccagcttaga gacacctgtt       300
     tgttcttcct attatgaaaa tagcccggag gagcccgagt gtcatgatga caattcccag       360
     gaagatgaag ggtttatggg catgtccccg ctcctacagg cccatcatgc tatggaacga       420
     atggaagagt ttgtttgtaa ggtgtgggaa ggccgatggc gagtgatccc tcacgatgtg       480
     ctaccggatt ggcttaagga taatgacttc cttctccatg gacaccggcc tcctatgcct       540
     tcctttcggg cctgttttaa gagcattttt agaatacaca cagagacggg caacatttgg       600
     acacatctcc taggttgtgt attcttcctg tgcctgggga tcttttatat gtttcgccca       660
     aatatatctt ttgtggcccc tctgcaagag aaagtggtct ttggcttgtt cttcttggga       720
     gccattctct gcctttcctt ttcatggctc ttccacacgg tgtactgcca ctcagaaggg       780
     gtctcccgac tcttctctaa attggattac tctggtattg ctcttctgat catgggaagt       840
     tttgttcctt ggctttatta ttctttctac tgtaacccac aaccttgctt catctacctg       900
     attgtcatct gtgtgctggg cattgcagcc attatcgtct ctcagtggga catgtttgcc       960
     acccctcagt atcggggggt cagagcagga gtgttcgtgg gcttaggcct gagtggaatc      1020
     atccctacct tgcattatgt catctcagaa gggttcctga aggctgccac catagggcag      1080
     ataggctggc taatgcttat ggctagcctc tatatcaccg gagctgccct ctatgcggcc      1140
     cgtatccctg agcgcttctt tcctggcaaa tgtgacatct ggtttcactc tcatcagctc      1200
     ttccacatct ttgtggttgc tggtgccttt gttcacttcc acggagtctc aaacctgcag      1260
     gaatttcgtt tcatgattgg cgggggctgc actgaagagg atgcactgtg atactctcca      1320
     ggaaccaggg actctgaccc tgagccaggc ctgcaggtcc tgcaggcctt cttactggct      1380
     gtcggtgcca gtgccagaga agccccaaaa cttggacagc ctcatgggcc ttgtgttggc      1440
     ccaagggctc catggggtac aagactaaga aaaaaaaaaa aaaaaaaaa                  1489
//


spacer
spacer