spacer

EBI Dbfetch

ID   BC063327; SV 1; linear; mRNA; STD; MUS; 3294 BP.
XX
AC   BC063327;
XX
DT   04-DEC-2003 (Rel. 78, Created)
DT   28-OCT-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Mus musculus heparan sulfate 6-O-sulfotransferase 2, mRNA (cDNA clone
DE   MGC:74252 IMAGE:6531439), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3294
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3294
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 794d3cc8982449124e0c80cedfa0b815.
DR   Ensembl-Gn; ENSMUSG00000062184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114871; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Michael Brownstein
CC   cDNA Library Preparation: Michael Brownstein /  Ted Usdin
CC   Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 53 Row: a Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 7657189.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3294
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_144"
FT                   /clone="MGC:74252 IMAGE:6531439"
FT                   /tissue_type="Brain, mouse"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10090"
FT   gene            1..3294
FT                   /gene="Hs6st2"
FT                   /note="synonym: 6OST2"
FT   CDS             72..1472
FT                   /codon_start=1
FT                   /gene="Hs6st2"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2"
FT                   /db_xref="GOA:Q80UW0"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR010635"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1354959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UW0"
FT                   /protein_id="AAH63327.1"
FT                   /translation="MDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVP
FT                   DPYRSEDESSARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNI
FT                   QLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCVPAVVDGKRD
FT                   ARLRPSRNFHYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGD
FT                   DWSGCPLKEFMDCPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKH
FT                   MAFFGLTEFQRKTQYLFEKTFNMNFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDME
FT                   LYSYAKDLFLQRYQFMRQKEHQDARRKRQEQRKFLKGRFLQTHFQSQSQGQSQSQSPGQ
FT                   NLSQNPNPNPNQNLTQNLSHNLTPSSNPNSTQRENRGSQKQGSGQGQGDSGTSNGTNDY
FT                   IGSVETWR"
FT   misc_difference 3264..3294
FT                   /gene="Hs6st2"
FT                   /note="polyA tail: 31 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3294 BP; 973 A; 707 C; 736 G; 878 T; 0 other;
     ggagcgaggc gagcacgggc caagctgcgg gattgacgta acgagcttgg gtttccccca        60
     gcgtcgggaa catggatgag aaatctaaca agctgctgct ggctttggtg atgctcttcc       120
     tatttgcggt gatcgtcctc caatacgtgt gccccggcac agaatgccag ctcctccgcc       180
     tgcaggcgtt cagctccccg gtgccggatc cgtaccgctc ggaggatgag agttcggcca       240
     ggtttgtacc ccgctacaat ttcagccgcg gcgatctcct gcgcaaggta gacttcgaca       300
     tcaagggcga tgacctgatc gtgttcctgc acatccagaa gactgggggc accacttttg       360
     gccgtcacct ggtgcgcaac atccagctgg agcagccatg tgagtgccgc gtggggcaga       420
     agaaatgcac ttgccaccgg ccgggtaaga gggagacctg gctcttctcc aggttctcca       480
     ccggctggag ctgcgggctg catgccgact ggaccgagct caccagctgc gtgccggcgg       540
     tggtggatgg caagcgcgac gccaggctga gaccttccag gaacttccat tacattacca       600
     tcctgagaga cccagtgtca cggtacttga gtgaatggag gcatgtccag agaggagcaa       660
     cttggaaagc atccctgcac gtctgtgatg gaaggccccc aacctctgaa gagctgccca       720
     gctgctacac cggtgatgac tggtctggat gccctctcaa agagttcatg gactgtccct       780
     ataatctggc caacaaccgc caagttcgca tgctatctga cctgactcta gtgggatgct       840
     acaacctctc tgtcatgcct gaaaagcaaa gaaacaaagt ccttctggaa agtgccaaat       900
     ccaatctgaa gcacatggcg ttctttggcc tcactgagtt tcagcgcaag acccagtacc       960
     tgtttgagaa gaccttcaac atgaacttta tctcgccgtt tacccagtat aataccacta      1020
     gggcctctag tgttgagatc aatgaggaaa tccaaaagcg tattgaggga ctgaattttc      1080
     tggatatgga gttgtacagc tatgctaaag acctctttct gcaaaggtat cagttcatga      1140
     ggcagaaaga acatcaggat gccaggcgga agcgtcagga gcaacgcaaa tttctgaagg      1200
     gaaggttcct tcagacccat ttccagagtc agagtcaggg tcagagccag agccagagtc      1260
     caggtcagaa tctgagtcag aatccaaatc ctaacccaaa tcagaacctg actcagaacc      1320
     tgagtcacaa tctgactccg agttcaaatc ccaattcgac ccagagggag aaccggggaa      1380
     gtcagaagca gggctcaggc cagggacaag gtgatagcgg caccagcaat ggcaccaatg      1440
     actacatagg gagcgtagag acatggcgct aactggcact caaaggcttg tgcacactgc      1500
     ttcccaaagc atcaccaaaa agatggcgtg tatcttacaa gatgaaaatg tccaaacaca      1560
     tcctgcttcc ttcatttggg aagttcaaaa aaaaaaagtg tagacgttgc ctttacagtt      1620
     gccttttgat tcagtgttat gctgtgtgtg ggtacaacaa atctcagtgt gtaattaaat      1680
     tgtctgtttt gggatgaact acttctgaaa tccaagagcc aaaccagact caccagaaat      1740
     tgcagcttag atattttaag acgttcttaa attaggtatg ggagacacaa agaaaacatg      1800
     aaatgtggcc gtttaaactt atggctaaga aacagacttt aagtgattcc ggatactctg      1860
     ttaaaactca gtcttgaaag caccccccct ccctgcaggg aagtataagt aaaaacatga      1920
     acagaactaa aagacactca aaactgttca tttccttgtt ttaacaagga gcctatttaa      1980
     acagaaaaac aactgatgat aaattttgcc aaactgtaga aaataaacaa tttctcactt      2040
     aaatgtagct gggtttatgt aaaaataatg gcttttcaaa tagatcggga ttcgtgtctt      2100
     gtaacttaac agatgtttaa aatttagaat ttttctacct tctgctgatt aaaaggtttt      2160
     aaacagggta tatctcatat taacaaagca ttttttccaa atggaatacc aatggaaaga      2220
     tccagtttcc agatggtttc tgggcactgt aattccaaca atttcgatct ttttggcgct      2280
     gcttctcatt cactttaagg cttctccgag ttgtgctcat tccaaatgaa tccatgtata      2340
     gaatttttct tcttcatcta aacaacgtgt tgctaaatct cttgtgctat ttaatcctgg      2400
     actaaagtca ggactttcta tagaattgtc ttatcaatgt ctgtgtagta aggtccttaa      2460
     gaagaactct caaacagaat aatttgtctc ttaatattgc tgaagttatt attcttcatc      2520
     agattgaact aaacctgaat gtgaactgtt aattatcttg tttattgtaa tgtttccagt      2580
     ttggctggct atttctggcc catggttctt ttcttgtatt gacagatttg tacacaataa      2640
     taagagcaaa aaattttctc aaagacaaca gtagactaat cattaagata gccagagttg      2700
     ctcaataaca ccaaaagctg cctcttgata attgagggga acacttctac caggattttg      2760
     tttgtgaaag atcaaaaata aagaatgttt tgcagcgaag ctaagtgtca gggacgtgca      2820
     agtagaggag aatagtttga tagtctgcat ctgtgaagag tattttgatg gtttcaatta      2880
     caaatggaac aaaggaagaa ttatatacac actgtgttgt gaaatatcat actgcttggc      2940
     agtttacacc tcatggttgt tgctacactt ctataagagc ttacattaat cccttggctt      3000
     tcaatcaaaa caaggtgacc agaagtggta ttcatgcttt caagagggac atgcttagaa      3060
     atatgatcat aaagtcacat ctgtcatagt ctgcccaagt gcatgacctg gtttcatctg      3120
     taataatatg gccacaagtt tggcaagaag ttgagtatct ggctctaaag agattttctt      3180
     gactctgagc tctgtgacaa tatttgcagc ttttgttttg tggtatttgc agtgttgaga      3240
     atgatgatac ctaaaaaaaa atctaaaaaa aaaaaaaaaa aaaaaaaaaa aaaa            3294
//


spacer
spacer