Dbfetch

ID   BC063260; SV 1; linear; mRNA; STD; MUS; 5735 BP.
XX
AC   BC063260;
XX
DT   06-DEC-2003 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus transforming growth factor, beta receptor I, mRNA (cDNA clone
DE   MGC:67113 IMAGE:6409765), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5735
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5735
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; bd84c1d00285c6c7b8f3290dd26b0615.
DR   Ensembl-Gn; ENSMUSG00000007613; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028267; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028226; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028176; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027967; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027406; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027933; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028083; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028050; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028074; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028722; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027131; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027484; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000007757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044234; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065644; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065699; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0065588; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065628; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065298; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066098; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065617; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0065245; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0065380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0065306; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065289; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066270; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065163; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064504; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 125 Row: i Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254607.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5735
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FO0"
FT                   /clone="MGC:67113 IMAGE:6409765"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dp"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..5735
FT                   /gene="Tgfbr1"
FT                   /note="synonyms: TbetaR-I, TbetaRI, ALK5, Alk-5"
FT   CDS             8..1519
FT                   /codon_start=1
FT                   /gene="Tgfbr1"
FT                   /product="transforming growth factor, beta receptor I"
FT                   /db_xref="GOA:Q64729"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:98728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64729"
FT                   /protein_id="AAH63260.1"
FT                   /translation="MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCE
FT                   TDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNK
FT                   IELPTTGPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEED
FT                   PSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRG
FT                   KWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSD
FT                   YHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNIL
FT                   VKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRA
FT                   DIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRW
FT                   QSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM"
FT   misc_difference 5667..5735
FT                   /gene="Tgfbr1"
FT                   /note="polyA tail: 69 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 5735 BP; 1615 A; 1059 C; 1234 G; 1827 T; 0 other;
     cgggaccatg gaggcggcgg ccgctgctcc acgtcgtccg cagctcctca tcgtgttggt        60
     ggcggcggcg acgctgctcc cgggggcgaa ggcattacag tgtttctgcc acctctgtac       120
     aaaggataat tttacctgtg agacagatgg tctttgcttt gtctcagtca ctgagaccac       180
     agacaaagtt atacacaata gtatgtgtat agctgaaatt gacctaattc ctcgagacag       240
     gccatttgta tgtgcaccat cttcaaaaac aggggcagtt actacaacat attgctgcaa       300
     tcaggaccac tgcaataaaa tagaactccc aactacagga cctttttcag aaaagcagtc       360
     agctggcctt ggtcctgtgg agctggcagc tgtcattgct ggtccagtct gcttcgtctg       420
     cattgcactt atgctgatgg tctatatctg ccataaccgc actgtcattc accaccgtgt       480
     gccaaatgaa gaggatccat cactagatcg ccctttcatt tcagagggca ccaccttaaa       540
     agatttaatt tatgatatga caacatcagg gtctggatca ggtttaccac tgcttgttca       600
     aagaacaatt gccaggacca ttgtgttaca agaaagcatt ggcaaaggtc ggtttggaga       660
     agtttggcga ggcaaatggc ggggagaaga agttgctgtg aagatattct cttctagaga       720
     agagcgttca tggttccgag aggcagagat ttatcagact gtaatgttac gccatgaaaa       780
     tatcctggga tttatagcag cagacaacaa agacaatggg acatggacgc agctgtggtt       840
     ggtgtcagat tatcatgagc atggatccct tttcgattac ttgaatagat acactgttac       900
     tgtggaagga atgatcaagc ttgctctgtc cacagcaagt ggtcttgccc atcttcacat       960
     ggagattgtt ggtacccaag gaaaaccagc tattgcccat agagatttga aatcaaagaa      1020
     tatcttggtg aagaaaaatg gaacctgttg tattgcagac ttgggacttg ctgtgagaca      1080
     tgattctgcc acagatacaa ttgatattgc tccaaaccac agagtaggca ctaaaaggta      1140
     catggcccct gaagttctag atgattccat aaatatgaaa cattttgaat ccttcaaacg      1200
     cgctgacatc tatgcaatgg gcttagtgtt ctgggaaatt gctcgacgct gttctattgg      1260
     tggaatccat gaagactatc agttgcctta ttatgatctt gtaccttctg atccatcggt      1320
     tgaagaaatg agaaaagtag tttgcgaaca gaagttaagg ccaaatattc caaacagatg      1380
     gcagagctgt gaggccttga gagtgatggc taaaattatg agagaatgct ggtatgccaa      1440
     tggagcagca aggctgacag ctttgcgaat taaaaaaaca ttgtcacaac tcagccaaca      1500
     ggaaggcatc aaaatgtaac tgaaacaccg tgggaactct gctctcttca tatctgctcc      1560
     tgggtgttta ggaggctggt tgttctacct cactgagaga acagagggct ctgcttcctc      1620
     ttgcagcagt ggaatatggt caactgaaag cttcccaggg tttctctggg cccagaggca      1680
     gccgtggggt cctttctgtg cactatggat acttcttcca gacagttaca gaatgttgtg      1740
     tagtctactt ttgtttttat taacaaagct tgtttttaaa gacaactgcc agcccttagg      1800
     gagctgctgt gctgttgacc ttctgtaagg gtgaaggagc tggggtgtgg cactaaatga      1860
     agcacttctg attttcactc ctagtagtac attctcagag gactctgaac cactagtgtt      1920
     tccttggttc actttgaatg tactgttcta taatttttca agatcttaaa ctaacacttt      1980
     aaactctata gtctaaaaaa tatgacctcg tggaggcgtg ggggcacagt tgctccgttg      2040
     tatttgtgca cagctccttc acactctgaa cacaacacac cttcacagta gggttgtgct      2100
     acaccagtaa gtgctacttt tgcatctgtc taagtggaaa cgaacagaac tacttaaagg      2160
     cggtgttaag tcctgtatca ttttcattca aaaagtttat ttttctgagt aacctaaacc      2220
     ttttctgggt ttgtttttgt tttttgaggg tttttgtgat agatgtcatt cagtcttcat      2280
     gcctttctcc tacccagatg tgcttgaacc actgaggcaa ggctgtagca ttgataagca      2340
     gtgactgcca tgcgggaaca ccccacagga gcactggagc tctgcagttg agacgtttag      2400
     cctgagttta ttttaagaag tgaagtggca ctccaaacat gtacagtgct ttatggatgt      2460
     aatcattatg gtatacagac tccttttgaa aggggaggct tgtctattgc cgaaggaaaa      2520
     gttgtatgct gttctgtaag ccatttcttt ttctttattt gatcaaagca gtgttttgtt      2580
     ttgttttgat ttttcttttt tggaaaggaa ttgcatttaa aattcaaatg tggttaatgt      2640
     taaataatag gcctttttct aggaaggcag atatagttaa tatgaatgta caagtgtagg      2700
     tgactttcac atgttatgta gctgtaagta tttgtggatt ctatcttggg aagggtagag      2760
     ttagtggagt tttgaggtct cactaccctt tgaggaaggc agcttttaat tcagtctttt      2820
     tatctcatat gtgcagatct tgcaactgct tgatttacat ggtagcaatg aattcagtgc      2880
     cacgttgata ctaggagaag cagcaactaa tagctattct gagtagaggc tctcttcata      2940
     tattcttggt catattaaat gtcaaagtca gtccgttggg tcttctcact gctgctggag      3000
     ttaggtggtt gagcctgggt tttacttcag tgctgtcaaa tctttgcagg gcttgtgtgg      3060
     ctttcaaagt cctttttatc actgtgatca tattctgggc ggggaaatgt tatcatcatt      3120
     gcttgagacg agatgttgaa catagtgata ccaatcccca gataaaaagg tcaaaataac      3180
     ctttagtgtt tagccaagaa gagattgtga ctattgatct gaagcagctg ggctctgtta      3240
     atgtcttatt tcaaacctag catacatttg aagactattt ggtcttaaac caaagtaact      3300
     gtaggacgaa tgacatacta cctagacatt agtgtccgtt tcatacgtca gaaacaccat      3360
     gggaaaaagt acctagagat tagtatcttt aatacaaatc tgagtttttt ctgtaattat      3420
     catgatttca tcaatgtaag taagggtttg ttgttacagt tgtatcacct gcttaaataa      3480
     gctcttgtgc tataatcagg tacttttggg gcctttgttt tcagtttttt ccatttctaa      3540
     cccttcgaga tctgctttat agaaatccag ggaccaatgt attttatcac taaaactgtt      3600
     tttatataat tttaagacca taccaaaagt tatctgagtt aaagttgtaa tacgtttctt      3660
     actttcttgc aaggaaatgg gtttttactg aagacacttc tcatgatatc tgaagttgaa      3720
     gaatcattat gtttttctta cctaagtgga taaaatgtgc tttgatgaat cagggaattt      3780
     tttaaagttc gaatttagtt ctaaattgag tttacatgtt tacagctaat tttttgtgta      3840
     gggatagttt gattctctag gtggccaata ctgaatataa aaataactta aaaattgaga      3900
     taggtcatgg ttaatgtggc tataactata tatacatcta attagagaaa tatttctatg      3960
     taattttgta gtgcagtctg ttgtttctat tgccaatcaa agacttcccc ccagccccaa      4020
     agtgtagtat ggctaagaca tatcttctga caaattacat attatcttgt caataccctg      4080
     gttaagctag catgaaggaa gtatgactta ctgaggctta cacaacttga gtcccttata      4140
     tcttcagctc tgtttttccc actctgcctt tctgctgccc cctggctcag agacttagtg      4200
     ttcctgaccc cacctccagc ctttggacct aagagctgct tttgagacct aaaatgaagt      4260
     gattgatgga agctgtgtga catttttcca cttccttgag tcactgggtg ttatgaggga      4320
     gtgatctgca aattggggta gggggtgccc ctactggtag ccctgctttg atgtcagctc      4380
     tgggcaaaga ttagggtgac agctaagtgg cagtggaagt tggcctcaga agtagtggcc      4440
     agctgtgtct ctagtaggac agtaaaggca tgaagctcag cctgtaatcc tgctactaca      4500
     gtagtactcc agaagtgcct tgaggccctg tgtggggctg tggccatcaa gaattccaga      4560
     ttttggttct cgctgcagac ttaagtggcc atgtagccat ttttgtaatc catacatgtt      4620
     tgactcttcc ctctgcaaat tgtcagatac gtaaaaccaa tgacaaacta ctacttaaca      4680
     tgcacaccaa aatctgccca gaagacattg tgatttcatt ccatgcactg aaggaatgat      4740
     tgtaaatcat ttctttgttc cttggtcatg ggagtgttct ggttctacat tgtggagatt      4800
     ccagctgttg ttctgttata gcccagcaga acaagtcgac gtgttgaaat tctgaagaat      4860
     agtttgggag tgcagtacag cttcatgtgt tggatgttga aactttcatg ggccctcttt      4920
     agaaaagcag aggactgtca gcacattatt tttaatcctg ttatgcactc gtacttattg      4980
     tcagtaacaa taagtacgag tattgaaaat attgtcagta acattcagtc tctttcttaa      5040
     agtgaatttg cttatttttc aatgagattt gtgagtttaa tattatgaac tgtgttttga      5100
     taatcccttt ttcacattgt gccaatggaa tggaatattt gatatttctt tatatgtcaa      5160
     ggagatgctt caatatgtca tttgctttaa acttaaatta cctctcaaga gaccaaggta      5220
     catttacctc attgtgtata taatgtttaa tatttgtcag catccaccag gtttgcaatt      5280
     ttatttctat aaagtgtgag tgttacgttg ctaagttact cagatggtac tgtattgttt      5340
     atatctgtac cccaaatgac atcatctaga ctttgttttc tgtgtcttat tgtatttgtg      5400
     cagtccttta accctgttgg tgtgattgct gccctttcag atatgtgcag gtgtctatag      5460
     aaattctcat ttaaggtgaa tggttttgag aaacctgtga agagagaagc ataaactgca      5520
     tttccccatc agttttttaa atgtacattg tatgtgtagt aatattccag atgaattgta      5580
     aataaaagct agggagatgc ttaaatttca tcctaacact acagtagaaa atggaagcaa      5640
     tgcaaataaa caactttttc ccaccaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      5700
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa                                 5735
//