Dbfetch

ID   BC063258; SV 1; linear; mRNA; STD; MUS; 2933 BP.
XX
AC   BC063258;
XX
DT   06-DEC-2003 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus protein tyrosine phosphatase, receptor type, O, mRNA (cDNA
DE   clone IMAGE:6419457), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2933
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2933
RA   Strausberg R.;
RT   ;
RL   Submitted (02-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; fd14eaa73234d4603f250f4f4cfbcdc7.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 125 Row: o Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6997246.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2933
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EW0"
FT                   /clone="IMAGE:6419457"
FT                   /tissue_type="Brain, mouse 15.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            <1..2933
FT                   /gene="Ptpro"
FT                   /note="synonyms: GLEPP1, PTP-BK, PTP-U2, PTPROt, PTP-phi"
FT   CDS             <1..1723
FT                   /codon_start=2
FT                   /gene="Ptpro"
FT                   /product="Ptpro protein"
FT                   /db_xref="GOA:Q6P4T4"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1097152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P4T4"
FT                   /protein_id="AAH63258.1"
FT                   /translation="NSLLYISWTYGDATTDLSHSRMLHWMVVAEGRKKIKKSVTRNVMT
FT                   AILSLPPGDIYNLSVTACTERGSNTSLPRLVKLEPAPPKSLFAVNKTQTSVTLLWVEEG
FT                   VADFFEVFCQQLGSGHNGKLQEPVAVSSHVVTISSLLPATAYNCSVTSFSHDTPSVPTF
FT                   IAVSTMVTEVNPNVVVISVLAILSTLLIGLLLVTLVILRKKHLQMARECGAGTFVNFAS
FT                   LEREGKLPYSWRRSVFALLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTNPVQLDDFD
FT                   SYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVS
FT                   MNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSHIIVMLTQCNEK
FT                   RRVKCDHYWPFTEEPIAYGDITVEMVSEEEEEDWASRHFRINYADEAQDVMHFNYTAWP
FT                   DHGVPPANAAESILQFVFTVRQQAAKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHE
FT                   FVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWLRKKQQFCISDVIYENVSKS"
FT   misc_feature    239..487
FT                   /gene="Ptpro"
FT                   /note="FN3; Region: Fibronectin type 3 domain"
FT   misc_feature    965..1651
FT                   /gene="Ptpro"
FT                   /note="PTPc; Region: Protein tyrosine phosphatases (PTP)
FT                   catalyze the dephosphorylation of phosphotyrosine peptides"
XX
SQ   Sequence 2933 BP; 802 A; 686 C; 683 G; 762 T; 0 other;
     caacagcctg ctgtacatca gttggaccta tggggatgcc accactgacc tgtcccactc        60
     tagaatgctg cactggatgg tcgttgcaga agggaggaag aaaattaaaa agagtgtgac       120
     acgcaatgtc atgacggcca tccttagcct gcctccagga gatatctaca atctgtctgt       180
     cacggcctgc actgagagag ggagcaacac ctccttgccc cgccttgtca agctcgaacc       240
     agcccctccg aagtcactct tcgcagtgaa caaaacacag acgtcagtga ccctgctgtg       300
     ggttgaggag ggtgttgctg atttctttga agtcttctgt cagcagctcg gctctggcca       360
     caatggcaaa ctccaggagc cagtagctgt gtcgtcccac gtggtgacca tctccagcct       420
     cctcccagcc actgcctaca actgcagtgt caccagcttc agccacgaca ctcccagtgt       480
     ccctacattc atagctgtct ccacaatggt tacagaggtg aaccctaacg tggtggtgat       540
     ctcggtgctg gccatcctca gcacactttt aattggactg ctcttagtga cccttgtcat       600
     tctccgaaag aagcacctgc agatggctag ggaatgtgga gctggcacgt ttgttaactt       660
     tgcatcctta gaaagggaag ggaaactccc ctacagttgg cgtaggagtg tgtttgctct       720
     cttaaccctg ctgccttcat gtctttggac tgactatctt ttggcatttt atattaaccc       780
     ttggagtaaa aatggcttaa agaagaggaa actaacaaac cccgttcagc tggatgactt       840
     cgattcttac atcaaggata tggccaagga ctcggactat aaattctctc ttcagtttga       900
     ggagttgaag ttgattggac tggatattcc gcactttgct gcagatctac cgctgaaccg       960
     atgtaaaaac cgctacacaa acatcctgcc gtatgacttt agccgggtga ggctagtctc      1020
     catgaacgaa gaggaaggag cagactacat taatgccaac tatattcctg gatacaactc      1080
     accccaggag tacattgcca cccagggtcc cctgccagaa accagaaatg acttctggaa      1140
     gatggtccta caacagaagt cccacatcat cgtcatgctc actcaatgca atgagaaaag      1200
     gagggtaaaa tgtgaccact actggccatt cacagaagaa cccattgctt atggggacat      1260
     caccgtggag atggtctctg aggaagagga ggaggactgg gccagtagac acttccggat      1320
     caactatgcg gacgaagcgc aggacgtgat gcattttaac tacacagcct ggcccgatca      1380
     cggcgtgcct ccagcaaacg ccgccgagag catcctgcag tttgtgttca cagtgcgaca      1440
     gcaagccgcc aagagcaaag ggcccatgat catccactgc agtgcgggtg tgggacggac      1500
     aggaaccttc attgccctgg acaggctcct gcaacacatt cgagatcatg aatttgtgga      1560
     catcttaggg ctggtatcag agatgcgctc ataccgaatg tcaatggtac agacagagga      1620
     gcagtacatt tttatccatc agtgtgtgca gctgatgtgg ctgaggaaga agcaacagtt      1680
     ctgcatcagc gacgtcatct acgagaacgt cagcaaatcc tagttcggaa tctggagcgg      1740
     tgaggacatg atacctgcgc atcctccctt gcttccagag tttttatagg ggcttttagt      1800
     cactttgcta aatcgagtcc ctgctgtgca gtatatggac aaggaggaga tttacctcct      1860
     agaaccaaga agaccttaag gagcctacag tatcatttgg agtcttttca cttctagatg      1920
     tttgatggac caaattcagt agaattccag aaaggtcacc aatgctcctt gaggggcagg      1980
     aagcgcaata cttcctgatg gctcagttgg ctctttgctg ctcgggttgg gttgattttt      2040
     tttttaagtg caataatttc tgtataattg tgatttttta cattcacaat tcagaatgtt      2100
     gaattgttat ctgcccacac catcgatcag tgccacagcc ttggaaataa ccaacatcat      2160
     tacggagttt tatctcatcc ctggaaaggc atggctacac aggaagacgt ggtgatgaat      2220
     ctccttcaaa gaaactgagc gagtgtgctc ctcgctccaa ccttgaagct acgggtcagg      2280
     agtaggcagg cagagggaag agagcggttc tactcaccca tcagccagct tatcttttcc      2340
     tatttcaaat atgaaaacct gtgtttcaaa gtagagtagg aaaaacatta tatgtctgac      2400
     ttgtcatagt gggtttcttc cttgttgaca gttgggagtt tcttccgtgg ctcttttgaa      2460
     ctaatgtcac ggtccttttt gaacagccag agttgattca acagttttga gtctgactct      2520
     gaactctgag atatcttggt gcctagcctt cacgtttatt tttctctgtg tccacctgtg      2580
     tacacaaaaa cagtttctcc aagagctata ggctgtaaaa atgcactttc tttctccacc      2640
     cagaggagct gggaattcag aagtcacgac aacaacaaac tcagcatgta aggacaggta      2700
     ttggacacca tcccttaaga acattgttga gtgtctctat ggattccgac aggagattct      2760
     ctgggtcttc tttgcatttc tgttgtcaga gtcattttaa cctgtgtagc tagtggcatt      2820
     atattctttg gattttgtat gattaaagta catgattgtg tgttgtgacc atgaaaaaaa      2880
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa             2933
//