spacer

EBI Dbfetch

ID   BC063064; SV 1; linear; mRNA; STD; MUS; 2586 BP.
XX
AC   BC063064;
XX
DT   06-DEC-2003 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus MAP kinase-activated protein kinase 2, mRNA (cDNA clone
DE   MGC:67217 IMAGE:5687007), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2586
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2586
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0d9b424963204d96e02d07d9a99cf8a7.
DR   Ensembl-Gn; ENSMUSG00000016528; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016672; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 124 Row: b Column: 6.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2586
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EH0p"
FT                   /clone="MGC:67217 IMAGE:5687007"
FT                   /tissue_type="Brain, day 18.5pc (3 -4 kb fragment)"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2586
FT                   /gene="Mapkapk2"
FT                   /note="synonym: MK2"
FT   CDS             19..1179
FT                   /codon_start=1
FT                   /gene="Mapkapk2"
FT                   /product="MAP kinase-activated protein kinase 2"
FT                   /db_xref="GOA:P49138"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027442"
FT                   /db_xref="MGI:MGI:109298"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49138"
FT                   /protein_id="AAH63064.1"
FT                   /translation="MLSGSPGQTPPAPFPSPPPPAPAQPPPPFPQFHVKSGLQIRKNAI
FT                   TDDYKVTSQVLGLGINGKVLRIFDKRTQQKFALKMLQDCPKARREVELHWRASQCPHIV
FT                   HIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYL
FT                   HSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLG
FT                   PEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVS
FT                   EEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKE
FT                   EMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARAVEDAALAH"
FT   misc_difference 2568..2586
FT                   /gene="Mapkapk2"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2586 BP; 572 A; 713 C; 697 G; 604 T; 0 other;
     cgcgagtcgc cgggcaccat gctgtcgggc tctccgggcc agactccgcc ggcgcctttc        60
     cccagccctc caccgccagc cccggcccag ccgccgccgc cgttccccca gttccacgtc       120
     aagtcgggcc tgcagatccg aaagaacgcc atcaccgacg actacaaggt caccagccaa       180
     gtgcttggcc tgggcatcaa cgggaaggtg ctgcggatct tcgacaagag aacccagcaa       240
     aaattcgccc taaagatgct ccaggactgt ccgaaggcgc gcagagaggt ggagctgcac       300
     tggagggcct cccagtgccc acacattgtg cacatcgtgg atgtctatga gaacctgtat       360
     gccgggagga agtgcctgct gattgtcatg gagtgtctcg atggtggaga gctctttagt       420
     cgaatccagg accgaggaga ccaggcattc acagaaagag aggcgtcaga gatcatgaag       480
     agcatcggcg aggccatcca gtacctgcac tcgatcaaca ttgctcaccg ggatgtcaag       540
     cctgagaacc tcttatatac ttccaaaagg cccaatgcca ttttgaaact cactgatttt       600
     ggctttgcca aggaaaccac cagtcacaac tctttgacca ctccgtgtta tacaccatac       660
     tatgtggctc cggaagtcct gggcccggag aagtatgaca agtcctgtga catgtggtcc       720
     ttgggtgtca tcatgtatat tttgctgtgt gggtatcccc ccttctattc caatcacggc       780
     cttgccatct ctccgggcat gaagactcgt attcgaatgg gccagtatga atttcctaac       840
     ccggagtggt cagaagtatc agaagaagtg aagatgctta tccggaatct gctaaaaaca       900
     gagcccaccc agagaatgac catcacagaa ttcatgaacc acccctggat catgcaatct       960
     acgaaggtcc ctcagactcc actgcacacc agccgtgtcc tgaaggagga caaggaacga      1020
     tgggaggatg tcaaggagga gatgaccagt gccttggcca cgatgcgtgt tgactatgag      1080
     cagatcaaga taaagaagat agaagacgca tccaaccctc tgcttctcaa gaggcggaag      1140
     aaagctcgtg ctgtggagga tgcggctctc gcccactgag ccgctctgtc tcccacccac      1200
     tggaggacaa gcaataactc tacatgaata tattttttag acaaagagac acaagttgcc      1260
     caatgctgcc tcctgttctc ttgggctgcg tggcgcccag aaatgcctcc ggctttattc      1320
     tgcccttggc tctggctccc ccgaggtggg ggctggagga tgtgtgaggg gcaaggtgct      1380
     cctgagcccg ttgctccttt gcattttatc tgtaatttgg cgtagagttt ttatggaacc      1440
     tgtcttcttg tccttttccc cactcctcac tccttcccca ggtcctttcc catctacaaa      1500
     ggctgaggct tatccacagg tgttgtggaa gttgttatag ggaaagtccc taggttgccc      1560
     tatctgtctc ctctggcctc ccactgtaac gtggggtcct cactggctct agaatctggg      1620
     agttccaggg agaaggcagc agagtggcag taggtggccc ttgcctcccg ctgaagccct      1680
     tagacatcac cagtgtgcac aacagagcag cacatgtgtg tgcatgtgtg tgtatgcctg      1740
     gatccatgcc agcgactggg cattggaggg tctagggaag gcggggctac agggactcct      1800
     gcttgaactg agcctgccta aatgcctagg tagcttgtct agatccagag ccaggtaatt      1860
     gtggcctctg tgttagctgg gcaggggagg cagtgagggg ttggggggca ctgacagcca      1920
     tcaggaggac tgggtcccct caggacccct ttccctgctg gtcccagatc cctgaggcac      1980
     tgatctactg agtagcctct gcttgccctt cttgccacga ttaacccact cttgtcgagt      2040
     tctctgaaat ttttagccat ttctcaatgg gctgtccact cccacggtga gcctgggaag      2100
     gttctatgcc tggaaaggca gttgcatttc atgcatctcc cctgatctct ggggtacctg      2160
     ccaacctccc ttcgacaagg gcaggaccac gtgtggtctt cctggatttc caccatgtgg      2220
     tctggtggat gggacagtct tcgcaccaaa gatgtcttga ctctgtccct gcccactagc      2280
     caccttaccc tctaactact caacctgggt gggggctccc caggattgag gaggagcagg      2340
     cggggaagag tctttgtgcc atggtccccc atgcccctcc tgctggagga ggggtgtctc      2400
     cctcaggggt tggtggagga ggggctcttg ggcatccctg ggcctggggc agggcccaga      2460
     tgtctgcagc tcctcccatg tctttgatgg tgtgttcaac actcagactg ttgtaaactc      2520
     tcgttttgta tgagcaaaat tgtctttact aaacaaattt aatagttaaa aaaaaaaaaa      2580
     aaaaaa                                                                 2586
//


spacer
spacer