Dbfetch

ID   BC063050; SV 1; linear; mRNA; STD; MUS; 3125 BP.
XX
AC   BC063050;
XX
DT   04-DEC-2003 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus myotubularin related protein 2, mRNA (cDNA clone MGC:66658
DE   IMAGE:5716297), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3125
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3125
RA   Strausberg R.;
RT   ;
RL   Submitted (02-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 285c21c4b00b5af00ef29d983e90d5bf.
DR   Ensembl-Gn; ENSMUSG00000031918; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034344; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034322; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034250; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034316; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034027; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034838; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033354; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034000; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034157; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034102; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034243; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034146; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034857; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033060; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033470; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000155679; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091168; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091243; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091185; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091173; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090744; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091695; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091316; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090674; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0090888; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090721; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0090907; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090742; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092008; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090762; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089778; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
CC   Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
CC   Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
CC   Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
CC   Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
CC   Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
CC   Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
CC   George Yang, Scott Zuyderduyn, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 124 Row: n Column: 15
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 23956229.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3125
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FC0"
FT                   /clone="MGC:66658 IMAGE:5716297"
FT                   /tissue_type="Mouse, brain 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..3125
FT                   /gene="Mtmr2"
FT   CDS             446..2161
FT                   /codon_start=1
FT                   /product="Mtmr2 protein"
FT                   /db_xref="GOA:Q6P572"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="MGI:MGI:1924366"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P572"
FT                   /protein_id="AAH63050.1"
FT                   /translation="MEEPALLPGENIKDMAKDVTYICPFTGAVRGTLTVTSYRLYFKSM
FT                   ERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIF
FT                   ENLMKYAFPVSNGLPLFAFEYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYE
FT                   LCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATVTRCSQPMVGVSGK
FT                   RSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDI
FT                   HNIHVMRESLRKLKEIVYPTIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTS
FT                   VVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNH
FT                   ADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGK
FT                   ENLPKKTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKP
FT                   QEPIHSRYKELLAKRAELQRKVEELQREISNRSTSSSERASSPAQCVTPVQTVV"
FT   misc_feature    461..646
FT                   /note="GRAM; Region: GRAM domain. The GRAM domain is found
FT                   in in glucosyltransferases, myotubularins and other
FT                   putative membrane-associated proteins"
FT   misc_feature    1448..1768
FT                   /note="PTPc_motif; Region: Protein tyrosine phosphatase,
FT                   catalytic domain motif"
XX
SQ   Sequence 3125 BP; 877 A; 696 C; 714 G; 838 T; 0 other;
     gccgcttccg gtctcggagc ctgcctggcg cggggctgac cgcggctgcg gccccgtgcg        60
     ctcctccctc tgcatctcgc gccggcggcc gcggagggcg cagcggcctc cagtttctcg       120
     cgccatggag aagagctcca gctgcgagag tctcggcgcg cagctcccgg cggcaaggct       180
     gcccagcgag gactcactgt ccagtgcttc tacttctcat tcagagaact cggtgcatac       240
     caaatcagct tctgctatat catcagattc catttcaacc tctgcagaca acttttctcc       300
     tgacttgagg gagtgcccag ctgcttgggt tttagttgat gccagacata gtcaagttga       360
     cagccaagat tagccatcac accagtgttc tatcctgttg aatccaattc tataggtcct       420
     gagggaggca aacaagttag cagaaatgga ggaaccagcc ctgcttccag gagagaacat       480
     taaagatatg gccaaagatg tgacttacat atgtccattc actggtgctg tgcgaggaac       540
     gctgactgtc acaagttaca ggttatattt caagagcatg gagcgggacc ccccatttgt       600
     tctagatgct tctcttggag tgataagtag agtagaaaaa attggtggtg catctagccg       660
     aggtgaaaac tcctatggcc tggaaactgt gtgcaaggat atcaggaact tgcgatttgc       720
     tcataaaccg gaggggcgaa caagaagatc catatttgag aatctaatga aatatgcatt       780
     tcctgtgtct aatggcttgc ctctttttgc ttttgagtat aaagaagtat tccccgaaaa       840
     tgggtggaaa ctgtatgacc cccttctaga gtacagaagg cagggaattc caaatgaaag       900
     ctggagaata acaaagataa atgaacgcta tgaactctgt gacacatatc ctgccctctt       960
     ggttgtgcca gcaaacattc ctgatgagga gctaaagaga gtggcatcct ttaggtcacg      1020
     gggccggatc ccagttttat cctggattca tcctgaaagt caagccacag tcactcgctg      1080
     cagccagccc atggttggag tgagtgggaa gcgcagcaaa gaagatgaga agtaccttca      1140
     ggccatcatg gactccaatg cccagtctca caaaatattt atctttgatg ctcggccaag      1200
     tgtcaatgcg gttgccaata aggcaaaggg gggaggttat gaaagtgaag atgcctatca      1260
     aaatgcagaa ctcgtttttc tggatattca taatatccat gttatgagag aatcattacg      1320
     gaagcttaag gagattgtgt accccaccat tgaagaaact cactggttgt ctaacttaga      1380
     atctacacac tggctggaac acattaagct cattcttgca ggggctctta ggattgctga      1440
     caaggtcgag tctgggaaga cgtctgtggt ggtacactgc agtgatggat gggatcgcac      1500
     agctcagctc acttccctgg ccatgctcat gttggatgga tactaccgaa ccatacgagg      1560
     atttgaagtc cttgtggaga aagaatggct gagctttgga catagattcc aactaagagt      1620
     tggccatgga gataagaacc atgctgacgc agacaggtca cctgttttcc ttcagtttat      1680
     tgactgtgtc tggcaaatga caagacagtt ccctaccgca tttgaattca atgagtattt      1740
     tctcattacc atcctggacc acttgtacag ctgtttattt ggaacattcc tttgtaacag      1800
     cgaacagcag agggggaaag agaatcttcc taagaagaca gtgtcactgt ggtcctatat      1860
     aaacagccag ctggaagact ttactaatcc tctttatgga agctactcca atcatgtcct      1920
     ttacccagta gccagcatgc gccacctaga gctctgggtg ggatattata taaggtggaa      1980
     cccccggatg aaacctcagg aacctatcca cagcagatac aaagaacttc ttgccaaaag      2040
     agcagagctt caaagaaaag tagaggaact tcagagagaa atttccaacc gctcaacctc      2100
     ctcttcagag agagccagct ctcctgcaca gtgtgtgact cctgtccaaa ctgttgtatg      2160
     aaaggactag gcccagggcc tcattgccag gaacctgaca ttccagcacc ttatgggtag      2220
     aaaaccttcc gtgtttaaaa cccatctact ggagaatcct tcggatgctg tatttatttc      2280
     aaatctctct tagatgagtt tagaaacata gcagtgcaag tgacaatgaa gatgatctca      2340
     ttcataatta aagtatgaca ctaatcttaa gtcacccaaa gaatactaaa gtactgcagt      2400
     cctgtattca cactgggagc aagtttttca tttaaaaatg tcttaaaacc ctgagcacct      2460
     ggtcagatct ccaggagggg agaaaagcaa ggccacctgc tgttgcacct gagagcacac      2520
     gcattgaggc ttgtgtcaga tccaaatatt cctttctcag tttccccaac ttttgtgata      2580
     tttaatatag taaaaagcat tgtcttgaga ttattatggc atagtaggtt tttttttttt      2640
     tttttttttt gctgctgaca ttgtaattag catattctca acagcaatta ggaaacaatg      2700
     ccttatatat gtgctttggg gggttgaagg gacaaagtag tagctgtcat ctactccatt      2760
     tgtgtattga tcacaaacat cacagaagac atcttaaaac cttactgtta ctctacttta      2820
     tctaaatgct atttggcaag ttttaagaca gtattttaaa aacttagaag tctgacttta      2880
     tgtgctgtgt aaatctcaca tggacacttt accaaagagc actctgcatg agttagtctc      2940
     agtgccagca agtaaagcct tgcttctctg ctcacccgag tccggtgctg gtggggacag      3000
     ttgactcctg gggtctgttt tactctgtac aagagccata tgtaatgtac tgtaacaaac      3060
     gagcttctta ccacttggtc ttttaattaa atgacttcaa actttgaaaa aaaaaaaaaa      3120
     aaaaa                                                                  3125
//