spacer

EBI Dbfetch

ID   BC062808; SV 1; linear; mRNA; STD; MUS; 726 BP.
XX
AC   BC062808;
XX
DT   30-NOV-2003 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus purinergic receptor P2X, ligand-gated ion channel, 7, mRNA
DE   (cDNA clone IMAGE:3465929), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-726
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-726
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7312c9b4693ed4092a07e7075d915c2c.
DR   Ensembl-Gn; ENSMUSG00000029468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086247; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Marcello Bento  Soares, Ph.D.
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 138 Row: m Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6754963
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..726
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Soares_mammary_gland_NMLMG"
FT                   /clone="IMAGE:3465929"
FT                   /tissue_type="Mammary gland, lactating mouse"
FT                   /note="Vector: pT7T3-Pac"
FT                   /db_xref="taxon:10090"
FT   gene            1..726
FT                   /gene="P2rx7"
FT   CDS             66..527
FT                   /codon_start=1
FT                   /gene="P2rx7"
FT                   /product="purinergic receptor P2X, ligand-gated ion
FT                   channel, 7"
FT                   /db_xref="GOA:Q6P5P0"
FT                   /db_xref="InterPro:IPR001429"
FT                   /db_xref="InterPro:IPR003050"
FT                   /db_xref="InterPro:IPR027309"
FT                   /db_xref="MGI:MGI:1339957"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P5P0"
FT                   /protein_id="AAH62808.1"
FT                   /translation="MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFAL
FT                   VSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFV
FT                   MTNYVKSEGQVQTLCPEDLSNLQESNQTSKPLLRNPRAKKEEGLSLELA"
FT   misc_difference 713..726
FT                   /gene="P2rx7"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 726 BP; 226 A; 170 C; 179 G; 151 T; 0 other;
     gctgtggtct agcctgggaa gtaggtctag cccaagtcca gcctgaacag agcgagcctg        60
     tcgccatgcc ggcttgctgc agctggaacg atgtcttgca gtatgagaca aacaaagtca       120
     cccggatcca gagcacgaat tatggcaccg tcaagtgggt cttgcacatg atcgtctttt       180
     cctacattag ctttgctttg gtgagcgata agctgtacca gcggaaagag cctgttatca       240
     gctccgtgca caccaaggtc aaaggcatag cagaggtgac ggagaatgtc acagagggtg       300
     gggtgacgaa gttaggacac agcatctttg acactgcaga ctacaccttc cctttgcagg       360
     ggaactcatt ctttgtcatg acaaactatg tcaagtcaga aggccaagtg cagacgctgt       420
     gtcctgagga tctttccaac ctccaggaga gtaaccagac ttccaaacca ctgctcagga       480
     atcccagagc caagaaggaa gaaggcttaa gcctggagct ggcctaaagt tctgctgcct       540
     cctggtagtt ctgtgatcgc agagaggccc agctcaaaag ggaggcagat acttggtctg       600
     tcagccagga gaatggtcaa aaagctcccc aatccatgca acaatcacaa aattaatgtt       660
     agagtttctt ttagagatta aaaaacaaaa caaaaaacca aagaaaacaa aaaaaaaaaa       720
     aaaaaa                                                                  726
//


spacer
spacer