spacer

EBI Dbfetch

ID   BC061160; SV 1; linear; mRNA; STD; MUS; 1490 BP.
XX
AC   BC061160;
XX
DT   26-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus Fas (TNF receptor superfamily member 6), mRNA (cDNA clone
DE   MGC:74297 IMAGE:30302649), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1490
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1490
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9a359f6f8385ecd6bde6fe4265ed0d92.
DR   Ensembl-Gn; ENSMUSG00000024778; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025691; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Michael Brownstein
CC   cDNA Library Preparation: Michael Brownstein /  Ted Usdin
CC   Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 53 Row: n Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6679750.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1490
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_176"
FT                   /clone="MGC:74297 IMAGE:30302649"
FT                   /tissue_type="Kidney, mouse"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10090"
FT   gene            1..1490
FT                   /gene="Fas"
FT                   /note="synonyms: CD95, APO-1, TNFR6, APT1"
FT   CDS             30..1013
FT                   /codon_start=1
FT                   /gene="Fas"
FT                   /product="Fas (TNF receptor superfamily member 6)"
FT                   /db_xref="GOA:P25446"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR008063"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="MGI:MGI:95484"
FT                   /db_xref="PDB:3OQ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25446"
FT                   /protein_id="AAH61160.1"
FT                   /translation="MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCS
FT                   EGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCD
FT                   EEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRK
FT                   QSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLS
FT                   KYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSD
FT                   AYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE"
FT   misc_difference 1460..1490
FT                   /gene="Fas"
FT                   /note="polyA tail: 31 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1490 BP; 493 A; 301 C; 328 G; 368 T; 0 other;
     gccgcccgct gttttccctt gctgcagaca tgctgtggat ctgggctgtc ctgcctctgg        60
     tgcttgctgg ctcacagtta agagttcata ctcaaggtac taatagcatc tccgagagtt       120
     taaagctgag gaggcgggtt cgtgaaactg ataaaaactg ctcagaagga ttatatcaag       180
     gaggcccatt ttgctgtcaa ccatgccaac ctggtaaaaa aaaagttgag gactgcaaaa       240
     tgaatggggg tacaccaacc tgcgccccat gcacagaagg gaaggagtac atggacaaga       300
     accattatgc tgataaatgc agaagatgca cactctgcga tgaagagcat ggtttagagg       360
     tggaaacaaa ctgcaccctg acccagaata ccaagtgcaa gtgcaaacca gacttctact       420
     gcgattctcc tggctgtgaa cactgtgttc gctgcgcctc gtgtgaacat ggaacccttg       480
     agccgtgcac agcaaccagc aatacaaact gcaggaaaca aagtcccaga aatcgcctat       540
     ggttgttgac catccttgtt ttgttaattc cacttgtatt tatatatcga aagtaccgga       600
     aaagaaagtg ctggaaaagg agacaggatg accctgaatc tagaacctcc agtcgtgaaa       660
     ccataccaat gaatgcctca aatcttagct tgagtaaata catcccgaga attgctgaag       720
     acatgacaat ccaggaagct aaaaaatttg ctcgagaaaa taacatcaag gagggcaaga       780
     tagatgagat catgcatgac agcatccaag acacagctga gcagaaagtc cagctgctcc       840
     tgtgctggta ccaatctcat gggaagagtg atgcatatca agatttaatc aagggtctca       900
     aaaaagccga atgtcgcaga accttagata aatttcagga catggtccag aaggaccttg       960
     gaaaatcaac cccagacact ggaaatgaaa atgaaggaca atgtctggag tgaaaactac      1020
     ctcagttcca gccatgaaga gaggagagag cctgccaccc atgatggaaa caaaatgaat      1080
     gccaactgta ttgacattgg caactcctgg tgtgttctct ttgccagcaa atggtagttg      1140
     atactcagtg agggtcaaat gactagcagg ttccagggac tgcttctgtt attctctgca      1200
     gttgctgaga tgaaccattt tctctgtcta ctgcaatttt tacattcaaa tgtccatgaa      1260
     atttgtatta aatgtgaagt ggaatctgca gtgtttgtgt ttatattcat atactatgaa      1320
     ctgaggagaa ttataaactg aaacaaatac tcgcagttaa ttgaagacct tccattgatg      1380
     gacagttctt ttcctctcta tgtggaaatg tataatagaa gaaataattt ttaaattaaa      1440
     gtatctcttt ttgcatttcg aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                 1490
//


spacer
spacer