spacer

EBI Dbfetch

ID   BC061053; SV 1; linear; mRNA; STD; MUS; 1416 BP.
XX
AC   BC061053;
XX
DT   26-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus renin 1 structural, mRNA (cDNA clone MGC:74164
DE   IMAGE:30313659), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1416
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1416
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 05ab381b4daef7996ebf0e8b81333eed.
DR   Ensembl-Gn; ENSMUSG00000070645; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094556; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Michael Brownstein
CC   cDNA Library Preparation: Michael Brownstein /  Ted Usdin
CC   Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 53 Row: o Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 13676836.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1416
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_176"
FT                   /clone="MGC:74164 IMAGE:30313659"
FT                   /tissue_type="Kidney, mouse"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10090"
FT   gene            1..1416
FT                   /gene="Ren1"
FT                   /note="synonyms: Ren1d, renin b"
FT   CDS             31..1239
FT                   /codon_start=1
FT                   /gene="Ren1"
FT                   /product="renin 1 structural"
FT                   /db_xref="GOA:P06281"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR012848"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="MGI:MGI:97898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06281"
FT                   /protein_id="AAH61053.1"
FT                   /translation="MDRRRMPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILE
FT                   ERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTG
FT                   SANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTV
FT                   GGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVF
FT                   SVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEG
FT                   CAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYT
FT                   LSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFA
FT                   LAR"
FT   misc_difference 1387..1416
FT                   /gene="Ren1"
FT                   /note="polyA tail: 30 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1416 BP; 328 A; 412 C; 360 G; 316 T; 0 other;
     acagctctta gaaagccttg gctgaaccag atggacagaa ggaggatgcc tctctgggca        60
     ctcttgttgc tctggagtcc ttgcaccttc agtctcccaa cacgcaccgc tacctttgaa       120
     cgaatcccgc tcaagaaaat gccttctgtc cgggaaatcc tggaggagcg gggagtggac       180
     atgaccaggc tcagtgctga atggggcgta ttcacaaaga ggccttcctt gaccaatctt       240
     acctcccccg tggtcctcac caactacctg aatacccagt actacggcga gattggcatc       300
     ggtaccccac cccagacctt caaagtcatc tttgacacgg gttcagccaa cctctgggtg       360
     ccctccacca agtgcagccg cctctacctt gcttgtggga ttcacagcct ctatgagtcc       420
     tctgactcct ccagctacat ggagaacggg tccgacttca ccatccacta cggatcaggg       480
     agagtcaaag gtttcctcag ccaggactcg gtgactgtgg gtggaatcac tgtgacacag       540
     acctttggag aggtcaccga gctgcccctg atccctttca tgctggccaa gtttgacggt       600
     gttctaggca tgggctttcc cgctcaggcc gttggcgggg ttacccctgt ctttgaccac       660
     attctctccc agggggtgct aaaggaggaa gtgttctctg tctactacaa caggggttcc       720
     cacctgctgg ggggcgaggt ggtgctagga ggtagcgacc cgcagcatta tcaaggcaat       780
     tttcactatg tgagcatcag caagactgac tcctggcaga tcacgatgaa gggggtgtct       840
     gtggggtctt ccaccctgct atgtgaagaa ggctgtgcgg tagtggtgga cactggttca       900
     tcctttatct cggctcctac gagctccctg aagttgatca tgcaagccct gggagccaag       960
     gagaagagaa tagaagaata tgttgtgaac tgtagccagg tgcccaccct ccccgacatt      1020
     tcctttgacc tgggaggcag ggcctacaca ctcagcagta cggactacgt gctacagtat      1080
     cccaacagga gagacaagct gtgcacactg gctctccatg ccatggacat cccaccaccc      1140
     actgggcctg tctgggtcct gggtgccacc ttcatccgca agttctatac agagtttgat      1200
     cggcataaca atcgcattgg attcgccttg gcccgctaag gccctctgcc acccagtaac      1260
     cctaggccaa gccaagctgg cagtcctggg ggccattttg tctggctttg tccccaacat      1320
     agggacactg gacacagaga ccctaacgag tgtttgcccc ttcacctgca ctcacccttc      1380
     cctgctaaaa aaaaaaaaaa aaaaaaaaaa aaaaaa                                1416
//


spacer
spacer