spacer

EBI Dbfetch

ID   BC060981; SV 1; linear; mRNA; STD; MUS; 1891 BP.
XX
AC   BC060981;
XX
DT   05-NOV-2003 (Rel. 77, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus thioredoxin domain containing 2 (spermatozoa), mRNA (cDNA
DE   clone MGC:74076 IMAGE:6770744), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1891
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1891
RA   Strausberg R.;
RT   ;
RL   Submitted (03-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; e3679b625b6b24d6f8905a4aa96e79e1.
DR   Ensembl-Gn; ENSMUSG00000050612; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050236; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jonathan Kuo, NIMH
CC   cDNA Library Preparation: Michael Brownstein /  Ted Usdin
CC   Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 53 Row: f Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 23943823.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1891
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_169"
FT                   /clone="MGC:74076 IMAGE:6770744"
FT                   /tissue_type="Testis, mouse"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10090"
FT   gene            1..1891
FT                   /gene="Txndc2"
FT                   /note="synonyms: Trx4, Sptrx1, Sptrx-1"
FT   CDS             294..1841
FT                   /codon_start=1
FT                   /product="Txndc2 protein"
FT                   /db_xref="GOA:Q6P902"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="MGI:MGI:2389312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6P902"
FT                   /protein_id="AAH60981.1"
FT                   /translation="MTLNNGGKANERGSNENPLQALSKNEAFLVPEFLDTAQSKEKAIA
FT                   SKVSNTLHMSTEESEFPQQVSSTPMFSENTVHPRHEVSPKPSSKNTQLKQENISKSSGY
FT                   SKQTNYSNTPKSLAKTTHPKQGSTLKPATNSTHYREDDIPKSSEDIIQPKKGDRPKSSE
FT                   DIIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSS
FT                   EDIIQPKKEDRPKSSEDSVPSKKGDRPKSSEDSVQPKKEDRPKSSEDSVQSKEGEVHKP
FT                   LKDSIQSKETKVPKSPQDSIQSKEDKTHRPLKDSVQSKESEEPKSSHESIQSKEDKIHK
FT                   PLKDSIPSKEGDIPKSPEDTIQSQEEITASEEDTIQSQEGNTIKSSEEDVQLSESKLLG
FT                   LGAEIETLEEGLVRVIKDKEEFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLSLK
FT                   HEDVIFLEVDTEDCEQLVQDCEIFHLPTFQFYKNEEKVGEFSGALVGKLERSISELK"
FT   misc_feature    522..1388
FT                   /note="Glutenin_hmw; Region: High molecular weight glutenin
FT                   subunit. Members of this family include high molecular
FT                   weight subunits of glutenin. This group of gluten proteins
FT                   is thought to be largely responsible for the elastic
FT                   properties of gluten, and hence, doughs. Indeed, glutenin
FT                   high molecular weight subunits are classified as
FT                   elastomeric proteins, because the glutenin network can
FT                   withstand significant deformations without breaking, and
FT                   return to the original conformation when the stress is
FT                   removed. Elastomeric proteins differ considerably in amino
FT                   acid sequence, but they are all polymers whose subunits
FT                   consist of elastomeric domains, composed of repeated
FT                   motifs, and non-elastic domains that mediate cross-linking
FT                   between the subunits. The elastomeric domain motifs are all
FT                   rich in glycine residues in addition to other hydrophobic
FT                   residues. High molecular weight glutenin subunits have an
FT                   extensive central elastomeric domain, flanked by two
FT                   terminal non-elastic domains that form disulphide
FT                   cross-links. The central elastomeric domain is
FT                   characterized by the following three repeated motifs:
FT                   PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping
FT                   beta-turns within and between the repeated motifs, and
FT                   assumes a regular helical secondary structure with a
FT                   diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm"
FT   misc_feature    1533..1835
FT                   /note="thiored; Region: Thioredoxin. Thioredoxins are small
FT                   enzymes that participate in redox reactions, via the
FT                   reversible oxidation of an active centre disulfide bond.
FT                   Some members with only the active site are not separated
FT                   from the noise"
XX
SQ   Sequence 1891 BP; 662 A; 470 C; 442 G; 317 T; 0 other;
     ggggaccatc ctagaagaga ggagaagaag gatgcacgtg ataggggaag gaatgctgtg        60
     agatgctgtc tcctggctgt ggcactcacg gactcacagc cgccacacaa gatcaaacca       120
     gcaagaccag ccagcgttcc aaccgacagc gctaatcgga ctcagtgggc tgcagaaaag       180
     agacggacat ggacttggcc atagaagaaa tgtttaagaa ggacaaacaa aagaataagg       240
     acaaggggct ggacatgaac agtgttcaag caggagctcc tgaagagtcg gacatgacac       300
     tcaacaacgg aggaaaagca aatgaaaggg gcagcaacga aaatccatta caggctttat       360
     ccaaaaatga ggcttttctg gtcccagagt tcttggatac agcccagtcc aaagagaagg       420
     ccattgcttc caaggtcagc aatacacttc atatgtccac agaagagtct gagttcccgc       480
     agcaagttag tagcaccccc atgttttcag agaataccgt ccatcccaga catgaagtta       540
     gccccaagcc ttcatcaaaa aacactcagc tgaaacagga aaatatttct aaatcctcgg       600
     gctactccaa gcagaccaac tatagcaaca ctcccaagtc cttggcaaaa accacccatc       660
     ccaaacaggg gagcaccctc aagcctgcaa cgaacagcac ccattacagg gaggatgaca       720
     ttcccaagtc ctcagaagac atcatccaac ccaagaaagg ggacaggccc aagtcctcag       780
     aagacatcat ccaatccaag aaagaggaca ggcccaagtc ctcagaagac atcatccaat       840
     ccaagaaaga ggacaggccc aagtcctcag aagacatcat ccaatccaag aaagaggaca       900
     ggcccaagtc ctcagaagac atcatccaat ccaagaaaga ggacaggccc aagtcctcag       960
     aagacatcat ccaacccaag aaagaggaca ggcccaagtc ctcagaagac agcgtcccat      1020
     ccaagaaagg ggacaggccc aagtcctcag aagacagcgt ccaacccaag aaagaggaca      1080
     ggcccaagtc ctcagaagac agcgtccaat ccaaggaagg tgaagtccac aagcccttaa      1140
     aagacagcat tcagtccaag gagactaaag tccctaagtc cccacaggac tcaatccagt      1200
     ccaaagagga taaaacccac aggcccttaa aggacagcgt tcagtcaaag gagagtgaag      1260
     aacctaagtc ctcccatgaa tccatccagt ccaaggagga taaaatccat aagcctttaa      1320
     aagatagcat cccatctaag gagggagata ttcccaagtc cccagaagat accatccagt      1380
     cccaggaaga aatcaccgcg tccgaagaag acaccatcca gtcccaggaa ggtaacacta      1440
     tcaagtcttc agaagaagat gtgcagctct cagagagcaa actcttaggc cttggagcag      1500
     aaatagagac cctggaggaa ggcttggtga gagtgatcaa agacaaggag gaatttgagg      1560
     aggtgctcaa agacgctgga gagaagctgg tggctgtgga tttctcagcc gcttggtgtg      1620
     gcccctgcag aatgatgaag ccactcttcc attccctgtc tttgaagcac gaggatgtga      1680
     tattcttgga ggtggacact gaggattgtg agcagctggt gcaagactgt gagatctttc      1740
     acctcccgac tttccagttt tataaaaacg aagaaaaggt gggtgaattt tctggtgccc      1800
     ttgtgggaaa actcgaaaga agcatttcag aattaaagta atcatatgtt ctgagaacac      1860
     tgaaaaaaaa aaaaaaaaaa aaaaaaaaaa a                                     1891
//


spacer
spacer