Dbfetch

ID   BC060743; SV 1; linear; mRNA; STD; MUS; 2841 BP.
XX
AC   BC060743;
XX
DT   26-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus glycogen synthase kinase 3 beta, mRNA (cDNA clone MGC:68385
DE   IMAGE:4022374), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2841
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2841
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 304ba97f7304f96d96fa1d3bd03c9641.
DR   Ensembl-Gn; ENSMUSG00000022812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023507; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 120 Row: h Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2841
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu30"
FT                   /clone="MGC:68385 IMAGE:4022374"
FT                   /tissue_type="Mammary tumor metastatized to lung.
FT                   MMTV-LTR/Wnt1 model. Expression driven by an MMTV-LTR
FT                   enhancer."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2841
FT                   /gene="Gsk3b"
FT                   /note="synonyms: GSK-3, GSK-3beta, GSK3"
FT   misc_difference 509^510
FT                   /gene="Gsk3b"
FT                   /note="6 bases in the mouse genome, GCCGCC, are not found
FT                   in cDNA."
FT   misc_difference 1279^1280
FT                   /gene="Gsk3b"
FT                   /note="1 base in the mouse genome, T, is not found in
FT                   cDNA."
FT   misc_difference 1404
FT                   /gene="Gsk3b"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS             1453..2715
FT                   /codon_start=1
FT                   /gene="Gsk3b"
FT                   /product="glycogen synthase kinase 3 beta"
FT                   /db_xref="GOA:Q9WV60"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1861437"
FT                   /db_xref="PDB:4NU1"
FT                   /db_xref="PDB:5AIR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV60"
FT                   /protein_id="AAH60743.1"
FT                   /translation="MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPG
FT                   QGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKL
FT                   DHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMY
FT                   QLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYY
FT                   RAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQI
FT                   REMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFF
FT                   DELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASD
FT                   TNAGDRGQTNNAASASASNST"
FT   misc_difference 1812
FT                   /gene="Gsk3b"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1908
FT                   /gene="Gsk3b"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2796..2841
FT                   /gene="Gsk3b"
FT                   /note="polyA tail: 46 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2841 BP; 706 A; 769 C; 751 G; 615 T; 0 other;
     cgcgactcgg gagtttcgcc gtccttaact cttgaggctt ttccctgagg gccaacagct        60
     ctgattggcc actgtcgcta ttgtcgactc ttctctctag ccagccacag gacaaggaga       120
     accctcttcc cttctgttcg gctaccttcg gcattcctcg ttgctggggc gtggtctccc       180
     agcggcgtct cctcattggt tatccaggtc gctcggcttt ttccggcagg agctgcaagc       240
     aagcgacgtc tctgattggt tccggcttgg gtttcggctc tacagccgaa gctggcgggc       300
     gcgggctcgg cgagcgattc ccagacgcct gtaacgcggg cggcggggcg ctgggcggtg       360
     taagggctgg gtgggggagg aaggaggcgg aggacgagta ggaaggggga gggggagtgg       420
     ggaagggcta ggcggctgcg cagacggcgc gcctcgcaca gagcagcccc cgacccggcc       480
     gaatgcgggc ttgtgtcgcc gccgtcgcct gggccgagtg acaaaggaag gaaggcagca       540
     aggaggagcc ggccttgcag ccgctgacag ggcttcgggc tccgggcaca gcgcggacac       600
     ttcccgagca gccgctgagc aaaggcgagg ggcggaggcc ggccgtgccg gggccacgga       660
     cgggggaggg gaccccgagg gacggaagcg gttgcctggt tcccatgtcc ccggcgtatg       720
     gggagcagtc agggagccgc tgcctggggt ctgaagggag ctgcctccgc cgccgctgcc       780
     gccatggccg ctggatccag ccaccgcctg cagctgctcc tggcgcaatg aggagaggag       840
     ccgccgccac cgcccgccgc tgactcgcga ctgcgctgcc ctccggttca cccggccgcc       900
     gccgccgtca gaccgccgga tcccgctgct gccggagccg cagcgtttgc cgtcgcatct       960
     ccgagccatc tcctccctcc ttcccatccc ccttctcttc aagcgtgagg ctcgtgatcc      1020
     ttccgccgct tcccttcttc attgactcgg aaaaaaatcc ccgaggaaaa atataatact      1080
     cagagtactt attttcaatc aagtatttgc cctcgttcac gtgatatata tatattttta      1140
     aggattccac tccacccttt ttctcctctt ccaggaaagg gaggtgaaag aattgtattt      1200
     ttctcccagc tctaaatcat ctatgtgtta aatatccgta ccgatctgtc ttgaagaaat      1260
     acatagctcc tttttttttc cttcttctta aatagctata caaaaggagt gaaaagccaa      1320
     gagaacgaag tctttctttc tctttcttgc gggagaactt aatgctgcat ttatcattaa      1380
     cctagcaccc taacataaaa caagaggaag aaaaggatta aggaaggaaa aggtgattca      1440
     agaagagcca tcatgtcggg gcgaccgaga accacctcct ttgcggagag ctgcaagcca      1500
     gtgcagcagc cttcagcttt tggtagcatg aaagttagca gagataaaga tggcagcaag      1560
     gtaaccacag tagtggcaac tcctggccag ggtcctgaca ggccacagga agtcagttat      1620
     acagacacga aagtgattgg aaatggatca tttggtgtgg tatatcaagc caaactttgt      1680
     gattctggag aactggttgc catcaagaaa gttctacagg acaagcgatt taagaaccga      1740
     gagctccaga tcatgagaaa gctagaccac tgtaacatag tccgactgcg gtatttcttc      1800
     tactcgagtg gcgagaagaa agatgaggtc taccttaacc tggtgctgga ctatgttccg      1860
     gagacagtgt acagagtcgc cagacactat agtcgagcca agcagacgct ccctgtgatc      1920
     tatgtcaagt tgtatatgta tcagctgttc agaagtctag cctatatcca ttcctttgga      1980
     atctgccatc gagacattaa accacagaac ctcttgttgg atcctgatac agctgtatta      2040
     aaactctgtg actttggaag tgcaaagcag ctggtccgag gagagcccaa tgtttcatat      2100
     atctgttctc ggtactacag ggcaccagag ttgatctttg gagccactga ttacacgtcc      2160
     agtatagatg tatggtctgc aggctgtgtg ttggctgaat tgttgctagg acaaccaata      2220
     tttcctgggg acagtggtgt ggatcagttg gtggaaataa taaaggtcct aggaacacca      2280
     acaagggagc aaattagaga aatgaaccca aattatacag aattcaaatt ccctcaaatc      2340
     aaggcacatc cttggacaaa ggtcttccgg ccccgaactc caccagaggc aattgcactg      2400
     tgcagccgtc tgctggagta cacacctacc gcccggctaa caccactgga agcttgtgca      2460
     cattcatttt tcgatgaatt gcgggaccca aatgtcaaac taccaaatgg gcgagacaca      2520
     cctgcactct tcaactttac cactcaagaa ctgtcaagta acccccctct ggccaccatc      2580
     cttatccctc cacatgctcg gattcaggcc gctgcttcac cgcctgccaa cgccacagca      2640
     gcctcagata ctaatgctgg agaccgtgga cagaccaata acgccgcttc tgcatcagct      2700
     tccaactcca cctgaacagc ccccaggagc cagctgcgcg ggaaagacca gcacttactt      2760
     gagtgccact cagcaacact ggtcacgttt ggaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2820
     aaaaaaaaaa aaaaaaaaaa a                                                2841
//