spacer

EBI Dbfetch

ID   BC060697; SV 1; linear; mRNA; STD; MUS; 5385 BP.
XX
AC   BC060697;
XX
DT   05-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus glutamate receptor, ionotropic, AMPA4 (alpha 4), mRNA (cDNA
DE   clone MGC:66941 IMAGE:6409918), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5385
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5385
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; af247eb9b4136e994a034acaf39f65ba.
DR   Ensembl-Gn; ENSMUSG00000025892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063508; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 125 Row: h Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254541.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5385
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FO0"
FT                   /clone="MGC:66941 IMAGE:6409918"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dp"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..5385
FT                   /gene="Gria4"
FT                   /note="synonym: gluR-C"
FT   CDS             388..3096
FT                   /codon_start=1
FT                   /gene="Gria4"
FT                   /product="glutamate receptor, ionotropic, AMPA4 (alpha 4)"
FT                   /db_xref="GOA:Q9Z2W8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2W8"
FT                   /protein_id="AAH60697.1"
FT                   /translation="MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFR
FT                   LAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVH
FT                   TLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRG
FT                   YSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNIL
FT                   EQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKK
FT                   LDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWG
FT                   QGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLI
FT                   QDAPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHI
FT                   GIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPF
FT                   MSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTE
FT                   EPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIII
FT                   SSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWT
FT                   YMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKG
FT                   YGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLS
FT                   NVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENG
FT                   RVLTPDCPKAVHTGTAIRQSSGLAVIASDLP"
FT   misc_difference 2937
FT                   /gene="Gria4"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 5353..5385
FT                   /gene="Gria4"
FT                   /note="polyA tail: 33 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 5385 BP; 1609 A; 1134 C; 1222 G; 1420 T; 0 other;
     ggggactgag accatgggga ggtgctaact tcctctccaa ccccccagcc cgggatccgg        60
     gctggcatac ccggcccccc ggggtagttt cctgccaagc tcaaccaaga atccaaaggc       120
     gacttggagg gcataaaaag aaaaacactg gttctgaaga ggggccccca cctccagagc       180
     cggttcctcg gcaaacgcgc ggaaggtagg aggaagggga tcagatactg gagactgtac       240
     gccaaaaccc cagcctgaag actcgctcca gagcctccct gaagacctgg gcgatctgcg       300
     ccatcatctt caatgcctct ctgaaaatca tttagcaaga gtgagagaaa gagaggagag       360
     cgcgcaccag ggagaggagc aaagaagatg aggattattt gcaggcagat tgtcttgttg       420
     ttttctggat tttggggact cgccatggga gcctttccga gcagcgttca aataggtggt       480
     ctctttatcc gaaacacaga ccaggaatac actgcttttc ggctagctat ctttcttcat       540
     aacaccagcc ccaatgcatc tgaagcccct ttcaatttgg tacctcatgt ggacaacatt       600
     gagactgcca acagttttgc tgtgacaaat gcattctgtt cccagtattc tagaggggtg       660
     tttgccattt ttggactcta tgacaagagg tcagtgcata ccttgacctc cttctgcagt       720
     gctctgcaca tctctctcat cacaccaagc ttccccactg aaggagagag ccagttcgtg       780
     cttcagctaa gaccttcatt gagaggtgca ctcctgagcc tcctggatca ctatgaatgg       840
     aattgttttg tcttcctgta tgatacagac agggggtatt caatacttca agctataatg       900
     gaaaaagcag gacagaatgg atggcatgtc agtgcgatat gtgtggaaaa ttttaacgat       960
     gtcagctaca ggcaactact agaagagctt gacagaagac aagagaagaa atttgtaata      1020
     gattgtgaga tagaaaggct tcaaaacata ttagaacaaa ttgtgagtgt tgggaagcac      1080
     gtcaaaggct accattatat catcgcaaat ttgggtttca aagatatttc tcttgagaga      1140
     tttatacatg gaggagcaaa tgtcactgga ttccagttag tagattttaa tacgcccatg      1200
     gtgacgaaac taatggatcg ctggaagaaa ctagatcaac gagaatatcc aggatctgaa      1260
     acacctccaa agtacacttc tgctctcact tacgatggtg tcttggtaat ggctgaaact      1320
     ttccgaagtc tcagaagaca gaaaattgat atttcaagga gaggaaatgc cggggattgt      1380
     ctggcaaacc ctgctgctcc ctggggccag ggaattgaca tggagagaac actgaagcag      1440
     gttcgaattc aaggactgac tgggaatgtt caatttgacc actatggacg tagagttaat      1500
     tacacaatgg atgtgtttga attaaaaagc acaggacctc gaaaggttgg ctattggaac      1560
     gatatggata aattagtctt gattcaagat gcgcctactc ttggcaatga cacagcagct      1620
     atcgagaaca gaacagtggt tgtaaccaca attatggaat ccccctacgt tatgtacaag      1680
     aaaaatcatg aaatgtttga aggaaatgac aagtatgaag gctactgtgt agacttggca      1740
     tctgaaattg cgaaacatat cggtatcaaa tataaaattg ccattgtccc tgatggaaaa      1800
     tatggagcaa gggatgcgga caccaaaatt tggaatggga tggtaggaga gcttgtgtat      1860
     gggaaagcag agattgccat tgcacctctg acaatcacgt tggtgcgaga ggaggtcatc      1920
     gacttttcta agccttttat gagtttaggc atctctatca tgatcaaaaa acctcagaaa      1980
     tctaaaccag gagtgttttc cttcttggac cctctggcct atgagatctg gatgtgcata      2040
     gtgtttgcat acattggtgt cagcgtggtc ttgttcctag tcagtaggtt tagcccatat      2100
     gagtggcaca cagaagagcc tgaggatgga aaagaaggac ccagtgacca acctcccaat      2160
     gagtttggca tctttaacag cctctggttt tccctgggtg cctttatgca acaaggatgt      2220
     gacatttcac ccagatccct gtccggtcgg attgttggag gcgtatggtg gttcttcact      2280
     ctcatcatta tctcatccta cactgctaat ctggctgcat tcctgacagt ggagagaatg      2340
     gtctccccca tagaaagtgc agaagacctg gccaaacaaa cagaaattgc ctatggaaca      2400
     cttgattcgg gatcaacaaa agaattcttc agaagatcaa aaatagcagt atatgaaaag      2460
     atgtggacct acatgcgatc ggcagagcca tctgtgttca ctagaactac agctgagggc      2520
     gtggcccgtg tccgcaagtc caagggcaaa tttgccttcc tcctggagtc cacgatgaat      2580
     gaatacattg agcagcgaaa gccctgtgac acgatgaaag tgggaggaaa cctggattcc      2640
     aaaggctatg gtgtagcgac gcccaagggt tcctcattaa gaactcctgt aaaccttgcc      2700
     gttttgaaac tcagtgaggc aggcgtctta gacaagctga aaaacaaatg gtggtacgat      2760
     aaaggtgaat gtggacccaa ggactcggga agcaaggaca agacgagtgc cttgagcctg      2820
     agcaacgtag caggcgtctt ctacattctg gttggcggct tgggcttggc aatgctggtg      2880
     gctttgatag agttctgtta caagtccagg gcagaggcga agagaatgaa gctgaccttt      2940
     tccgaagcca taagaaacaa agccaggtta tccatcactg ggagtgtggg agaaaacggc      3000
     cgtgtgctga cccccgactg ccccaaggcc gtacacacag gaactgcgat tagacagagc      3060
     tcgggattgg ctgtcattgc atcggaccta ccataaaaac caaaaaatta attgagtgcc      3120
     ttaatcaaac tgtgttggtg actgatggaa acgcagcccc gagggacagg ccaagcgtgg      3180
     gtcttggcta aacccatcct ttgactgagc aggaaggaca tcctgagtgc cggacagaac      3240
     cagtgcatga gttccgcacg gaaatgcaga ctcggatttt tttatcagga aatctcacag      3300
     tttagttttt tggggggagt gggtggggta ccttaggtgt attaacagca acagatctca      3360
     cttgagcgca cttaaaacta atcagactgg ccagttagcg cattaaactg tgaagttctt      3420
     tctcagaaag gtcgtggtca ccacagccag ggatcaacag ttaatagagg tcaaagaacc      3480
     tgctacctgt gtctccagaa cacccatata gtccatggaa taatcttccg ctgagacaag      3540
     ccgtcactaa catgtgatag gaaaataata aatagataaa gcctgtgaac aaacaatgag      3600
     atttaaagaa agtatttaca gttactttgg aaataaaaca atactgaaac atgcttgctt      3660
     tttaactgaa gttaatccag tagaggacaa cgcaattgtt ttttctaacc atcttaggga      3720
     acaatacatt gcaataattg ataatagtgc catcactgta ataaacttta gagacttttt      3780
     ttaatgtaaa agttgttggt caccttgttt cctgtaacct tcactctgtc acacaagttg      3840
     gctcataggt tgtgtttgtc tatcagaaat aagaaaaaca caagtgaaga aaatgttggc      3900
     atgaagtcat ccatctgcaa tgaaaaacct aaaagactac gggtcactca tgttatcaat      3960
     ataatttata atcctgttca gtgtacaaaa ttgtgggttt tgtactcacc caaaagacta      4020
     aaacaccagt ttttcttaca gtatctatct acagagctta ttctccccta ttatttggga      4080
     aactctgaga ctccatattg cagaagtcaa ggaataggcc atataagaaa atgtagcttg      4140
     tttttattat ttctgcatat ttatttctag atcttgggct catttgttaa cagaataagt      4200
     tgtcaaaggt aaagtccttg agtctgggaa tgagccatcg ttccaaaacc aacacaccct      4260
     gtgtggaaat tttacttgac tctgttttgc tgcatagaat tcagtgtctc ttggccattc      4320
     cccctcattc ctatactaaa ttctttgaag acactggtaa cagtttgtgg tagactacag      4380
     ttgaaaaaac tcaatcctta tttctaccaa gtaattgtga gtaaaattat accatgatca      4440
     tttttaagaa aagaaaaccc ttatggttca aaaggtctgg ttcatttgaa atgatgaatg      4500
     agttcaatga tacagttttt aaaaaaccaa aacaaacaaa caaacaaaaa caaatcacag      4560
     attgagggat ctttgcagaa agcacaaatt aggatgatgc ccaaagtgtg gccttgaaga      4620
     atgagttgag ttttcacagg agaaggtgct ggtaagatcc taggcgtgag cagcacacat      4680
     agctgcttct tttatcagtg tttcatgtac aaggcttgtg caaccaggtg gcctggtgag      4740
     ggcacagggt gtgacaccat ggaagctctg tcagaaatat ggagaattgg tttccttccc      4800
     tcaatactta caatcccatt caataactgt gtgtcactac aatgtaatcc ttataataca      4860
     tgtatgcact gtcctttggg aaaggttact tctctgttgt tgagcaatga ttcatttcac      4920
     aacctaggcc actccctggt atcttcctct tcctctctca ctcctaccca agctctcagc      4980
     cagcaaatgg acctccacag cacacggaac acggcatcta ctgtgtcttt gatctgtaga      5040
     tcttttttgt ctttacctga ctgtcacaca tccttcagcc ctgaaattga attttatgtg      5100
     tactgagaag atttccatga ttacccacca ccctgcccat gacactgagt tacctgccat      5160
     tcttaatgtt tcttacccat catggcactc atcgtactgc attgtaattg cctgtgtact      5220
     tgtctataaa ctactagact gtcagctcct tgagggcagg gactgtgtct attttgttca      5280
     cagttgtatc cccagcaccc agcacagtgc ctggcatatt gtaggtgctt aataaatatt      5340
     tgttgaatga aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa                      5385
//


spacer
spacer