spacer

EBI Dbfetch

ID   BC060618; SV 1; linear; mRNA; STD; MUS; 4768 BP.
XX
AC   BC060618;
XX
DT   04-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus RAB6B, member RAS oncogene family, mRNA (cDNA clone MGC:77988
DE   IMAGE:6406134), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4768
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4768
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0dabc889f421edbc974fc507d4f2ee25.
DR   Ensembl-Gn; ENSMUSG00000032549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035155; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254255.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4768
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FO0"
FT                   /clone="MGC:77988 IMAGE:6406134"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dp"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4768
FT                   /gene="Rab6b"
FT                   /note="synonym: 9630015C03"
FT   misc_difference 7
FT                   /gene="Rab6b"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   CDS             84..710
FT                   /codon_start=1
FT                   /gene="Rab6b"
FT                   /product="RAB6B, member RAS oncogene family"
FT                   /db_xref="GOA:P61294"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:107283"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61294"
FT                   /protein_id="AAH60618.1"
FT                   /translation="MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQAT
FT                   IGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQT
FT                   SKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNV
FT                   KQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC"
FT   misc_difference 984
FT                   /gene="Rab6b"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 4736..4768
FT                   /gene="Rab6b"
FT                   /note="polyA tail: 33 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4768 BP; 1203 A; 1219 C; 1138 G; 1208 T; 0 other;
     cgcccttctc ctctcccctc cctgctcctt caccgcttcc tcctcctcct cctcctcctc        60
     gcccggcccc agctgccagc accatgtccg cagggggaga ttttgggaac ccgctgcgaa       120
     aattcaagtt ggttttccta ggggagcaga gcgtcgggaa gacgtctctg atcacgaggt       180
     tcatgtatga cagcttcgac aacacctacc aggcaaccat cgggattgac ttcttgtcaa       240
     aaaccatgta cttggaagac cgtacggttc gactgcagct ctgggacact gctgggcaag       300
     agaggttccg cagcctgatc cccagctaca tccgagactc cacggtggct gtggtggtat       360
     atgacattac taatctcaac tccttccagc agacttctaa atggattgat gacgtcagga       420
     cggagagggg cagtgacgtg atcatcatgc ttgtgggtaa caagacggat ctggctgata       480
     agaggcagat aaccatcgag gaaggagaac agcgggccaa agaactgagc gtcatgttca       540
     tcgagaccag cgcgaagact ggctacaacg tgaagcagct cttccgacgt gtggcgtcag       600
     ctctgcccgg catggagaat gtccaggaga agagcaaaga agggatgatt gacatcaagc       660
     tggacaagcc tcaggagccc ccggccagcg agggcggctg ctcctgttaa tgcaccgccc       720
     actcggcttc ctcagcgcca ctcacttgtt ttgcctccta tagcttccta acggggtggg       780
     aactgagttt atcaagactg gaggatcttt cttttctctc tctctctctc tctaggagta       840
     gggtgggaca tggggaggga ggctgggcat cagggaccac gtcactctta acagctgtta       900
     cctaaacaac tattttttgg tttggttgta atatattgta ctttattaag attgccaaaa       960
     actgttaaaa tttaaaaaaa aaaatttaaa tcatgtgtat acaacttttt gccagattag      1020
     aaaagtagtc atttttattt gaaagaagtg cttttttgtt tgtttgtttt tgtatatttg      1080
     taaacttaca gagaacctct ccacacactt cttccttcct gttctcttgg aactgtgtgt      1140
     cacctctatt ttcctcctac ccccgccccc cccagcccag aaaattaaag caattaactg      1200
     aacagtagta attacattct agttctgggt cacatggccc aaaccaacca aacccgcact      1260
     ccacagtcaa atccaacttt aatctaacaa aacagcctct gagggggtat tgtcgagttc      1320
     ttccctggca gagtgggaca cattggcagg cccctgagag gagatgaagg cccgtggact      1380
     gtagattcag cagcagctcc ttggctgctt ccgcctcttc tccttccctg aaaaaaataa      1440
     ccatagagcc agaaagcaca ggcaacagtg tgttctctgg gctgacccgg tgacagacag      1500
     caagaagtta ctggaaggat ggggtgcgct tggcagctga gggctgaggc agtgtgtaat      1560
     ctactggccc aaccattgac acacatggtt aggctgactc gccaactcaa tgtgtgatgc      1620
     tgggtggctc agggacactg aagcctaggg cacctgccat cactgcaact accattgagg      1680
     aagtgagagg agtcggccat gactccggac actccatgtt gtcagaccct tggatactaa      1740
     tcttgccgaa cgttgttctg gaaaagctga ttccttgatg tgtcctcacc tctggcgtgg      1800
     tacgtttgaa atctttgtat gaataccttt gggagtgttg gcagctgcac tgcacgcatc      1860
     ttggagtcac tgtggggttt ccagaaggct gctgccccag ggtactgcaa cttgcccccc      1920
     agcaggctgt ccttgctatt tccactcatt ccccagactg aagaccttca gagtctctta      1980
     gcagagtgct cttctcaaag cagaatagct cttatattct aaacgctccc ggactcactg      2040
     cccctgtctg cctttgggca ggcctggggc agtgactcta atcagagcag cctagcccca      2100
     tagcattggc tcttctttca gactgctggt gggcagagtg aattgcctcc acaaggcaga      2160
     actccaacaa ggaggttggg atgaattatg gaatctctca aagaatgagt tcaaaatggc      2220
     agcctgtgtg gcagggctga ttctgtgagt gggcccgtca tgcgactcca tcctgggaga      2280
     ctgtgtcaaa gccggttctg atgatgaaga gaggaagcag gaccgccctg ggtacctcct      2340
     ccagaaggca aggaccaatg tacgagcata atcgaaacgt cacgtgttta gtttttatat      2400
     gtgtgtacat aattatacat agagatagac ttgtgtatac acccttcgcg cgcacacata      2460
     cacacactca catcctcaca tatacatgtg ctcagtgtat atcctcgtct ctcccgctca      2520
     caacttggaa cttacattgt gattccggtt tttggaagtt caaaagtatg cagtgtattg      2580
     aaataagaaa taactcaata ttgtcaaata acttgtggtt gtcttgcctt caataaaata      2640
     gtgcatagat gtgttaaact acaagcaaaa gtagtccaca gaactacctt taccactgct      2700
     ttttgtacct gtgtgcacag gtgtgcatgc cgtcgtgggc cagtgtcccc cactgtggac      2760
     accccaccca tgtggtgctt gttggaagaa agcatactta gcccgtggtg acagcagcct      2820
     ggttggcagt gaggggcttt gctggtggcc tctggcagag ccccactgac agcactctct      2880
     actggctttc actgaatgaa tgtagggtga attttaacct tctggacact gaataacctt      2940
     tcttgtattc ctgtaactcg aattagaaaa tccgttcact tctcttgtgc acacagtcta      3000
     agacatcatg gcctgctact agaaacagca ggtaccatgg cagatgccat ttctggtcga      3060
     tctggcctaa ggagccctgc cttcctagct tgtacacaaa accccctcct tgagtttaga      3120
     ctctcccagc cctgcggccc ctgagaatta gggttctgcc ccattgctcc cccactccag      3180
     aggtgccctg gccttatttc ctcagccaag ctacccatct ccttcccaaa aggcaatcaa      3240
     ggcagccagg ccccaacaga actaactgta gtggacctgg gctttccccc tgaccgccac      3300
     caccatccta cttgtacgta ggatccaatc aggttctcat aaagacatcc tgaaattatc      3360
     tgtgccccca tctttgctaa attcagatca gtcagaggac aaaatggagg gttcctctta      3420
     gggcatgatc ccaatgtcgt aattcagttc ctctctctgg acactgcctg gcctggcaga      3480
     tgggcatggc cctcctcctt ttctttaaga gacttgaaag agagttgtca gcaaaactgt      3540
     gagcagtgca gagattgtga aagggcaggt agtgtaagta gtattgttgt ggagtcagag      3600
     gttagaatgc tgggtggtta gagccttgct gctgccagtc actgctcccc gttgccatct      3660
     ttaaacattt cgcaatatct caagatccag gaaggcatgg ccatgtcagt tcaatgtctc      3720
     aggcaacaaa gacaagggtt gcaaggtggt agctaggaat atagacgcct gggcctagtc      3780
     tctgtaaccc agtggctaac cagtgtcaga gatctaagca gggctggctt cagcctcctg      3840
     taggcagggc agtttatccc ttttccatat ggatggggga gaggctgtca gcaaagtggc      3900
     tgaagagagc taagttagag ctacccaaga gccagccagc aggagtctgt gtcaaatgct      3960
     cagggctcga tgctcactag tttctaaact acctctcccc caagaatggg aggcaccatc      4020
     accttgccac agcactggga gccaaaccct tcctgtttca cgggtgggag aaccagaaca      4080
     gaaaaggtca cctgcaagcc agagaggatc agaactagtg ttggcattct tgatccgttg      4140
     ctgaccttgc ggtgtccaga caggactgct gtgctagcgt cccttaagcc atctctactc      4200
     catggctagt acctaagggt cttcccagcc tggctagcta gagagaagat aggtgcattt      4260
     tgggctctca ctgtaaagaa gagtggtccc caaatctact tgcattgtct tgtgtacaca      4320
     cacacacaca cacacacaca caccccagta gtcagggtac ccttttaatt tttgtttgaa      4380
     atcaacttct tcactgtttg gaaatcttgc agtttcaatg tgcacactcc ttggactcca      4440
     gaccctgtct gattgatact ctctgcaggg tataattatc aggaaatcca cgcagcggga      4500
     gttcagatgg gcccttcagg aggcaggaag cctccatagc aacgaaggcc agcctgccat      4560
     tgtgatgtgt tgacttctca cctcacctgt cctttaaagt gaggagcaga gggcggcatt      4620
     tctatctgta ctgggctcag aaggcacagt ggccatattg actttacatt caactgtgta      4680
     atatgtggaa aagactcagc atgttggtca aacaataaac tgtcctaatt ctcgaaaaaa      4740
     aaaaaaaaaa aaaaaaaaaa aaaaaaaa                                         4768
//


spacer
spacer