spacer

EBI Dbfetch

ID   BC060617; SV 1; linear; mRNA; STD; MUS; 4708 BP.
XX
AC   BC060617;
XX
DT   04-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus UDP-N-acetyl-alpha-D-galactosamine:polypeptide
DE   N-acetylgalactosaminyltransferase 10, mRNA (cDNA clone MGC:79216
DE   IMAGE:6836791), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4708
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4708
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 036a2d7c89bc45f40f0fc21dd79cc159.
DR   Ensembl-Gn; ENSMUSG00000020520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066987; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 46877106.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4708
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FI0"
FT                   /clone="MGC:79216 IMAGE:6836791"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4708
FT                   /gene="Galnt10"
FT                   /note="synonyms: GalNAc-T9, ppGaNTase, Galnt9, GalNAc-T10"
FT   CDS             101..1912
FT                   /codon_start=1
FT                   /gene="Galnt10"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 10"
FT                   /db_xref="GOA:Q6P9S7"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1890480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6P9S7"
FT                   /protein_id="AAH60617.1"
FT                   /translation="MRRKEKRLLQAVALALAALVLLPNVGLWALYRERQPDGSPGGLGA
FT                   AVAPAAVQELHSRQKKTFFLGAEQRLKDWHNKEAIRRDAQRVGYGEQGKPYPMTDAERV
FT                   DQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLR
FT                   TVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRM
FT                   LGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAG
FT                   DAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLE
FT                   IWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMD
FT                   EYAEYIYQRRPEYRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAA
FT                   AWGEIRNVGTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQ
FT                   HTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRVFMN
FT                   TCNPSSLTQQWLFEHTNSTVLENFNKN"
FT   misc_difference 3149
FT                   /gene="Galnt10"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 4686..4708
FT                   /gene="Galnt10"
FT                   /note="polyA tail: 23 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4708 BP; 1063 A; 1317 C; 1348 G; 980 T; 0 other;
     ggcgtcgcgg ccgctactgc tggccgaact gctgccgccg ccgggtggac gggcggacgc        60
     gcaaagccgg gggcgggcgc ggcggggcgg accggccccg atgaggcgca aagagaagcg       120
     gctcttgcag gcggtggctc tggctctggc ggccctggtc ctgctgccca acgtggggct       180
     ttgggctctg taccgcgagc ggcagcccga cggcagccct gggggattgg gggcggcggt       240
     ggcccccgcg gcggttcagg aattacacag tcgacaaaaa aagacatttt tcttgggagc       300
     tgaacaaagg ctgaaggact ggcataacaa ggaggctatc aggagggacg cacagcgcgt       360
     aggatatgga gaacagggga agccttaccc catgaccgat gccgagagag tggaccaggc       420
     gtaccgggaa aatggattta acatctacgt cagtgataaa atctccctga atcgctctct       480
     ccccgatatc cggcacccaa actgtaacag caagctctac ctggagacgc tccccaacac       540
     cagcatcatc atccccttcc acaacgaggg ctggtcctca ctgctgcgca ctgttcacag       600
     cgtgctcaac cgctcgcccc cagagctagt ggcggagatt gtgttggtcg atgacttcag       660
     tgatcgagag cacctgaaga agcccctgga ggactacatg gcccttttcc ccagcgtgag       720
     gattctccgg accaagaaac gggaaggcct gataaggacc cgaatgctgg gggcatcagc       780
     tgccaccgga gatgtcgtca ctttcttaga ttcacactgt gaagccaacg tcaactggct       840
     cccccctttg cttgaccgca ttgctcggaa ccggaagacc atcgtgtgcc caatgatcga       900
     tgtcatcgac cacgatgact tccggtatga gactcaggct ggggacgcca tgcgtggtgc       960
     cttcgactgg gaaatgtatt acaaacggat cccaatccct ccagagctgc agaaggctga      1020
     ccccagtgac ccatttgagt ctcccgtgat ggctggaggg ttgttcgctg tggaccggaa      1080
     atggttctgg gagttgggtg gctatgaccc tggcttggag atctggggag gagagcagta      1140
     tgagatctcc ttcaaggtgt ggatgtgtgg gggccgcatg gaggacatcc cctgctccag      1200
     agtgggccac atctacagga agtatgtgcc ctacaaggtc cctgccggag tcagcctggc      1260
     ccggaacctg aagcgagtgg cagaggtatg gatggatgaa tacgcagaat acatctacca      1320
     gcgcaggccg gagtaccgcc acctctcagc tggagatgtc gtggcccaga aaaagctccg      1380
     agtctccctc aactgtaaga gcttcaagtg gtttatgacc aaaattgcct gggacctgcc      1440
     caagttctac ccacccgtgg aacctccggc tgcggcatgg ggggagattc gcaatgtggg      1500
     cacaggactg tgcacagaca cgaagcttgg cacactgggc tccccactga ggctcgagac      1560
     ctgcatccgg ggccgaggcg aggctgcttg gaacagtatg caggtcttta ccttcacctg      1620
     gcgggaggac atccggcctg gagaccctca gcacaccaag aagttttgct tcgacgctgt      1680
     ctcccacacc agcccagtca ccctctacga ctgccacagc atgaagggca accagctgtg      1740
     gaaataccgc aaggacaaga cgctgtacca ccctgtgagc ggcagctgca tggactgcag      1800
     cgagagtgac cacagggtct tcatgaacac ctgcaatccc tcctccctca cccagcagtg      1860
     gctctttgaa cacaccaact cgacggtctt agagaatttc aacaagaact gagtccttag      1920
     accttgacaa acccctcagg ttcctgtgga gctcataaac cttcctcctg tgggagaaga      1980
     ggcatcggtg ggcaccaagg tgctgggttc ttgaaggact gacatggtgg ggccacgggg      2040
     agaacagacc ataccaatgg ctctccaaga aggcggagcc tgctcacatc atagcagagc      2100
     tcaccagcct gtcagcatgt tccctaagtg ttaggaatcg cctgggcagc cttgagccat      2160
     gaggttgccc ttgcagacag gacagtgccc tagaaaggaa ggtggtatcg gccttgggac      2220
     agcttaaacc tgtgtgccag ctgctggcaa ggaagtctgc ctgttcttga gggaactgct      2280
     agaattgccc agcttctgtg ttggtccagg gcaatgagag gccattggga cttccgagtg      2340
     ctccatagct agcactggcc agcaaccagg cgaggggccc cttcctctgc agccagatgt      2400
     aaaggatgtc tcccctggct ctctgggtat ttcagatgcc cgttctagtt tcagggctac      2460
     ctgggcacca ggtcgtcagg gctagttcag ccggctaagt agacctccag accgaacagc      2520
     tcccagccaa tgcttccaaa gccctttctc cgtgcttttc cttggcggct ccctgccttg      2580
     gagaggaacc ggtgctgtga gggatcacct ccagagtctc ctggggggtg gcttccccca      2640
     gataatgact gctgtggttc caacctcaca gaaccctgga gtttctggaa agttctgtgg      2700
     ttctgttgaa agcatagatg agccatggca cgtgtgggca tataacgcaa gcagccaggt      2760
     gtcaggcaac ccctgaccca agcagaggcg gtagggcacc agaagcttcg gtccaaccca      2820
     atgccgtcac agccacagcc tcgtgaggtg tgaggacatc acctttagcc ccatgtctca      2880
     aacatgaact caccctccaa ggagctggtc acttgccagt gaagtaactg agacatggtc      2940
     ctgaggccag agctctgcct tagagatgct gggatcgggg tcatcgggtc cccaggctcg      3000
     tcgggttggt gctgtagaac cacctccacg tagcccctgt gctgtcacag ctcacttgtg      3060
     gatttctagt gcccttttcc atatgagcac tctgtctgac aagtggccgg ctgggaagga      3120
     gtcaaaaagg ggagtgggtg ggtgtccaaa atccagcagg gatgcgtgtt gcagccaagg      3180
     ggagttgagt cctcagagag caatgcggcc ttgtttcaat aaaaaccgtg ccttttacaa      3240
     agagaaaatg cagccgagca gctgattccc taaacttgaa ccacttacta gtgccttgct      3300
     agacagacag acagacagac aggggagcgt ggagaaggga cacttattcg ggtcctatga      3360
     gcccaatgag tgtctttacg tctgacttca agcagaaagt gcagagcaga acctgagacc      3420
     cagaggcccc cacagcaggg acaactgcct atttgtgcgg ccctccctga gacaggacag      3480
     ctctagagac ctgacaagcc cagaagtgct ctgcctgaac ctcactatca ggggcgagct      3540
     gagcagctgg gtttccagcg gatgccgagc aggtggttag ggtggttaag gcagatgctg      3600
     ccgcaagcca tccctagcct cactcgctcc cttgctcgcc cgattcattc catcctcatc      3660
     tggttccgtc cccttctcca gcagtcactt cctctgagcg cacctcagca tttgtgactg      3720
     ctgaactctg accttagagc ctaagacttg aggaggtgtg tcacaggaag aaccaggttg      3780
     gcttggtggc tggctgcaga tacttaatcc ccaccttgtt tgggcttcag gtgtggaaat      3840
     ccttgtcctg aagagtcagg tttctactct gctgatgggc ctgtgccaca gcccacgcag      3900
     caggccgggc ggctggcctc ttcctccaaa gctttattca gaggctaaga ctacaaaaac      3960
     aagatgtggt tagaaaggcg gcctcccctc cgccccggag attccagaaa cattttggaa      4020
     tgcagtgtcc ttgccatgag gccattgtgt ggcaggcagg ctgtcttacc ctgccctgcc      4080
     aactagagct tctggcttta aaagcagcca gcaatgatag atcttgcgtt gcggcagtga      4140
     gctgctctga tgggcggcct agtggatctc caaagtcagc atcatgactc cccttcagtc      4200
     cttcctgtca cgctcctccc tgcgtggacc cctcgcttca gcagtcccta cttctcacag      4260
     aggagactgt ctgcatccag tgctcagggc agcctgtttg tctaaagtca ggcagtgtga      4320
     aaggaacaaa gagtgcaatt ccaccctgaa ttcatcagca cttgccgctg aggctttctc      4380
     cggcaaatcc tactcatatt ttggttcaag gttttgatgc tgagccaggg ccctgctgcc      4440
     accattaggt gagagtggta gctacatccc aggtttcaag atcttaacgc ggtccactca      4500
     gctctgacag ggagtccagg ggctgcaggc agggaagctg ggcactgaga cagggttctg      4560
     ggggcggggg aggggcggat cccaagacca cccacctctc ctggaagaga gagccttgta      4620
     aggaatgact tatcctgttc agttgtgact gtggttgttc aataaacctc cagactttct      4680
     ctaaaaaaaa aaaaaaaaaa aaaaaaaa                                         4708
//


spacer
spacer