Dbfetch

ID   BC060060; SV 1; linear; mRNA; STD; MUS; 1710 BP.
XX
AC   BC060060;
XX
DT   28-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus glutamate receptor, metabotropic 3, mRNA (cDNA clone
DE   IMAGE:5699031), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1710
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1710
RA   Strausberg R.;
RT   ;
RL   Submitted (20-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; d1c287056d8c108e327025a8a1a90fda.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1710
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EQ0"
FT                   /clone="IMAGE:5699031"
FT                   /tissue_type="Brain, whole, 18.5 dpc mouse embryo"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1710
FT                   /gene="Grm3"
FT                   /note="synonyms: Gprc1c, mGluR3"
FT   CDS             <1..1362
FT                   /codon_start=1
FT                   /gene="Grm3"
FT                   /product="Grm3 protein"
FT                   /db_xref="GOA:Q6PAT5"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001234"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PAT5"
FT                   /protein_id="AAH60060.1"
FT                   /translation="GKKLYKDYLLKINFTAPFNPNKGADSIVKFDTYGDGMGRYNVFNF
FT                   QHIGGKYSYLKVGHWAETLYLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWI
FT                   CIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPEDYIRWEDAWAIGPVTIACLGFM
FT                   CTCIVITVFIKHNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAKPSPVICALRRLGL
FT                   GTSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWL
FT                   ILETPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFN
FT                   EAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHI
FT                   VLFQPQKNVVTHRLHLNRFSVSGTATTYSQSSASTYVPTVCNGREVLDSTTSSL"
FT   misc_feature    448..1221
FT                   /gene="Grm3"
FT                   /note="7tm_3; Region: 7 transmembrane receptor
FT                   (metabotropic glutamate family)"
XX
SQ   Sequence 1710 BP; 476 A; 398 C; 367 G; 469 T; 0 other;
     ggaaagaagt tgtacaaaga ttatttgctg aaaatcaact tcacagctcc attcaaccca        60
     aataaaggag cagacagcat tgtgaagttt gacacttacg gagacgggat gggaagatac       120
     aacgtgttca acttccagca tataggtgga aagtattcct acttaaaagt tggccactgg       180
     gcagaaactt tatatctaga tgtggactct attcattggt cccggaactc agtccccact       240
     tcccagtgca gtgatccctg tgcccccaat gaaatgaaaa acatgcagcc aggagatgtt       300
     tgctgctgga tctgcatccc atgtgagccc tatgaatacc tggttgatga gttcacctgc       360
     atggattgtg gccctggcca gtggcccact gcagacctat ctggatgcta caaccttcca       420
     gaggattaca tcaggtggga agatgcctgg gcaataggcc cagtcactat tgcctgcctg       480
     ggttttatgt gtacatgcat agtcataact gtttttatca agcacaacaa cacacccttg       540
     gtcaaagcat caggccgaga actctgctac atcttgttat ttggagttag cctgtcctat       600
     tgcatgacat tcttcttcat tgctaagcca tcgcctgtca tctgtgcatt gcgccgactt       660
     gggcttggga cctcctttgc catctgttat tcagctctcc tgaccaagac aaactgcatc       720
     gctcgcatct ttgatggggt caagaatggc gctcagaggc caaaattcat cagccccagt       780
     tctcaggttt ttatctgcct gggtttgata ctggtgcaaa ttgtgatggt gtctgtgtgg       840
     cttatcttgg agactccagg tactagaaga tacaccctgc cagagaagcg ggaaacagtc       900
     atcctaaaat gcaatgtcaa agattccagc atgttgatct ctctgaccta tgacgtggtt       960
     ctggtgattc tatgcactgt gtatgccttc aaaacaagga agtgtcctga aaacttcaat      1020
     gaagccaagt tcataggctt caccatgtac accacctgca tcatctggtt ggcattcctc      1080
     cctatatttt atgtgacatc aagtgactac agagtgcaga cgacaacaat gtgcatctcc      1140
     gttagcttga gtggtttcgt ggtcttgggc tgtttgtttg cccccaaggt gcacattgtc      1200
     ctgttccaac cccagaagaa tgtggtcaca cacagacttc acctcaacag gttcagtgtc      1260
     agtggaactg cgaccacata ttctcagtcc tctgcaagca catatgtccc gacagtgtgc      1320
     aacggaaggg aagtcctgga ctccaccacc tcatctctgt gattgtgact cgcagttcag      1380
     ttctgtttat aggctgttag acgaagtgct cacatgctgc tccagaatat ggaaacagaa      1440
     caaaaacaac aaccctagta ccttcttttt tttttttttt ttttttagaa acagtaaaat      1500
     aaattatttt tgaggactgt atggtatata gtgatgtgct acaactttct aggctgattt      1560
     tagtgcccct attaacagcc cctccccagg acatggaaat aaccattgtt tacagagctg      1620
     agcattggtg acagggtctg acagggtcag tctactaaaa gaaaacaaaa caaaacaaaa      1680
     aaaacaaaaa acaaaaaaaa aaaaaaaaaa                                       1710
//