spacer

EBI Dbfetch

ID   BC059833; SV 1; linear; mRNA; STD; MUS; 4926 BP.
XX
AC   BC059833;
XX
DT   10-OCT-2003 (Rel. 77, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus K+ voltage-gated channel, subfamily S, 2, mRNA (cDNA clone
DE   MGC:69631 IMAGE:6838254), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4926
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4926
RA   Strausberg R.;
RT   ;
RL   Submitted (07-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 5712086c8f19f589fe2222007cb65e76.
DR   Ensembl-Gn; ENSMUSG00000050963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072868; mus_musculus.
DR   RFAM; RF00485; K_chan_RES.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. James Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
CC   Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
CC   Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
CC   Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
CC   Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
CC   Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
CC   Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
CC   George Yang, Scott Zuyderduyn, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 132 Row: n Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6680549.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4926
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_GH0"
FT                   /clone="MGC:69631 IMAGE:6838254"
FT                   /tissue_type="Brain"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4926
FT                   /gene="Kcns2"
FT                   /note="synonyms: Kv9.2, E130006J24Rik"
FT   CDS             174..1607
FT                   /codon_start=1
FT                   /product="Kcns2 protein"
FT                   /db_xref="GOA:O35174"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003971"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1197011"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35174"
FT                   /protein_id="AAH59833.1"
FT                   /translation="MTRQSLWDVSDTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGR
FT                   LLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQE
FT                   IEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDG
FT                   QPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPG
FT                   EDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVV
FT                   ESSPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGI
FT                   SIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGI
FT                   LVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMAS
FT                   LTNMSRSSPSELSLDDSLH"
FT   misc_feature    228..533
FT                   /note="K_tetra; Region: K+ channel tetramerisation domain.
FT                   The N-terminal, cytoplasmic tetramerization domain (T1) of
FT                   voltage-gated K+ channels encodes molecular determinants
FT                   for subfamily-specific assembly of alpha-subunits into
FT                   functional tetrameric channels. It is distantly related to
FT                   the BTB/POZ domain pfam00651"
FT   misc_feature    852..1400
FT                   /note="ion_trans; Region: Ion transport protein. This
FT                   family contains Sodium, Potassium, Calcium ion channels.
FT                   This family is 6 transmembrane helices in which the last
FT                   two helices flank a loop which determines ion selectivity.
FT                   In some sub-families (e.g. Na channels) the domain is
FT                   repeated four times, whereas in others (e.g. K channels)
FT                   the protein forms as a tetramer in the membrane. A
FT                   bacterial structure of the protein is known for the last
FT                   two helices but is not the Pfam family due to it lacking
FT                   the first four helices"
XX
SQ   Sequence 4926 BP; 1228 A; 1087 C; 1187 G; 1424 T; 0 other;
     atttccttgc ctcctcccaa atctccgcgc ccccttcttg gcccagccct gccagtgcgc        60
     atctcagctt gggtcccgcc tgtctgcggc gagagggcgg gggcgtctcc ttggtctgct       120
     cacaggcaag gtgtagcgcc cccgcgcggc gcgggcgcct gggcatctcc agcatgaccc       180
     gccagagcct gtgggatgtg tccgataccg acgtcgagga tggagagatc cgcatcaatg       240
     tgggtggctt caagagacgg ctgcgttccc atacgctgct gcgcttccct gagacacgcc       300
     tgggccgtct gctcctctgc cactcgcgag aggccattct ggaactctgc gatgactacg       360
     atgacgttca gcgtgagttc tacttcgacc gtaaccccga gctcttcccc tatgtgttgc       420
     atttctacca caccggcaag cttcacgtca tggctgagct gtgcgtcttc tccttcagcc       480
     aggagatcga gtactggggt atcaatgagt tcttcatcga ctcttgctgc agctatagct       540
     atcacggccg caaagtggaa cctgagcagg agaaatggga cgagcagagt gaccaggaaa       600
     gcaccacttc ctccttcgat gagatcttgg ccttctataa tgatgcttcc aagttcgatg       660
     ggcaacccct gggcaacttc cgcaggcagc tgtggctggc gttggacaac ccaggctact       720
     cagtcctaag cagggtcttc agtgtccttt ccatcttggt ggtgttgggc tccatcatca       780
     ccatgtgcct caatagcctg ccagacttcc aaatccctga tagccagggt aaccccggtg       840
     aagaccccag gttcgaaatt gtggagcact ttggcattgc ttggttcaca tttgagttgg       900
     tggccaggtt tgctgtggcc cctgactttc ttaagttctt caagaatgct ctaaacctta       960
     ttgatctcat gtccattgtc ccattttaca taactctagt ggtgaacctg gtggtggaga      1020
     gttctcctac cttggctaac ttgggcaggg tggctcaagt cctgaggcta atgaggatct      1080
     tccgaattct caagctggcc agacactcca ctggcctccg ctccttggga gccaccctga      1140
     agtacagcta caaggaagtg gggttgctct tgctctacct ctcagtgggg atttccatct      1200
     tctctgtggt ggcctacacc attgaaaagg aggagaacga aggcctggcc accatccctg      1260
     cctgctggtg gtgggccact gtcagtatga ccacagttgg gtacggagat gtggtcccag      1320
     ggacaacagc tgggaagttg actgcctctg cctgcatctt ggcaggcatc ctggtggtgg      1380
     tcttgcccat cactttgatc ttcaataagt tctcccattt ctatcggcgc caaaagcaac      1440
     ttgagagtgc tatgcgcagc tgtgactttg gagatggaat gaaagaggtc ccttcggtca      1500
     atttaaggga ctactatgct cataaagtta agtccctcat ggcaagtctg acaaacatga      1560
     gtaggagttc acctagtgaa ctgagtttag atgattctct acattagctg gaccccgact      1620
     tacattgctg atctgctgct tgtggttcta gcacaatcag ggcaatttta gggctgtggc      1680
     ataagaaatc atccctgccc tagagggaga gctgcatggg acataagccc tagattgctt      1740
     ttgcaatgtt tagagaggtt tcttttttct tttgaggatg gtgtgtctaa taacatgcct      1800
     ttgcacctct cagtgaagtg acactcactg gtgtttgcat catggcaaaa aaaaaaatgt      1860
     tcacctttct gccagatgag tatctagaat gccaatttct ctgtccactg tgtacagtat      1920
     tctaatgctc atatcccagc attacctgtg agtggaattg tctgtgctcc tatttccgag      1980
     gctgctgtat gggttccagt gacaacacat ctgtctatga ggtcagcaag gatatcgtga      2040
     gatttggatc acaaccatgt gaaaataatc tcaattatgt atcccttgct ttcatttacc      2100
     tttaatacca aaacagagag atcgcaaagc taagcacact tgaccaatgc aaatcttcga      2160
     gttgtctttc tacttggtcc tgtccttgtg atgtgcatga atgcaccagt cattttaaag      2220
     aaagatatgt attgatgtat atctcctaag tgtcagtgta aagagaatgt tacttagtcg      2280
     atatgtagta aagactgaat gtttttcctc caaacagtta aatttaggac agcgacttta      2340
     gctaaacatg gaccaaaccc caggagttca tgtaggctaa gcccttttac tgatggtcag      2400
     gcctcttttc atttatttct ggctgagatg ctcaatccag gccattttga ccaaagtttg      2460
     ctgtgtcttg gtattagcat gtttttcaag catctctttt ttaagatgtt taggaataag      2520
     gccgtgctgt ctttctcctc cactggaaga agtttgtgtt ttgttgtctt tgtgaggtaa      2580
     gcactgtcag gttgctggca agggcaatag cttaaatatt ttcttgcctg ctctaaaagc      2640
     ccataaaatg aatgttcttt tgtttctgag cagagtttcc tttaggtagt tttgcttcta      2700
     ggacacagga tagtgtatgt atagtgtttg attgccttga gttcctgcct tggcatggaa      2760
     acctggtagt gcagagcata ttcaagatgc agacatgcat gaaggcaggt ggcttaccca      2820
     gggtggaaac actgtagctt ttatttccat tgcaattgca atggggtttg ggggacaggg      2880
     gtagaagtca aaagaaaaga gttataaagc caaaaactac tttataagat ataaataact      2940
     gtgagcttct ttaaaagctt aaaactagta aaatagaaaa caaaaacaac aaacaaccct      3000
     ttcaaccatt aagctgtgtt gaagggttac ctctatttcc ttttccaaca cactgttcag      3060
     ttaacacaaa acattatgaa ggggcacctg ggcccccttt aagaaaattc tttcccatca      3120
     ttgtctaagt aatctgatgg ttttccagtg gctttcatta ttgttgagtc tttggcaagg      3180
     ctatagaatc cagggatcca aatacggaga taaacaggct tttaatccaa agtttgggcc      3240
     tactcttaat tggtccattt tgtgttttag tcagttaagg acaatccaca cttcacaggg      3300
     gtgtggaatg gatcttctca gagggctctg tgtactagtg gttgccatgg tgactacagt      3360
     gtgggcgatt tgttggatga atgcactgac catttaatgc ccttgagcct ccagttcaga      3420
     tctttcatca gactggagac tgatgagggg cagaaggtgg caacctccta gtgcctacgt      3480
     gcagacacat ctatgtctat tattccaaag cagcaggaat gtgaggttga cttcaaggaa      3540
     ccccgcctgt gaatcagaag acaggagttg gttttgggag tttgcatatg gaactcttgt      3600
     tgttggctgg tatcttcagc actagaagac caaggatgta taaaactgtt cccagttgca      3660
     ctgaaggcag gggacagcct aacctgtgag gactgtttgg tttgctgagg ctgatggtat      3720
     accataactg ggcatgaatt gcatggtcac tgaccatgaa gctgatggaa agaagaaaag      3780
     aggagatgca gagtaactta gccactctcc taaggatttt tctaaatgaa catgtttaac      3840
     accaaaaagg agatacctgc aaggatatga aagctggaaa acttgacttt tcttttttgg      3900
     tgatgacttg ttttatctgg tgcctttcat tgggggaatc ccaaagtgct ttagagactg      3960
     tctttttaac atttcttgta gatatatgta taattgtaaa agaatattcc tttgcccacc      4020
     aagactttta gtcgcttctg agcatgaaaa ggtcccagga gcattaagtt cccccaagca      4080
     gtagtttcat agaccttgag ggagggccat ccagatggct gggctctgca gtgatctcca      4140
     tagaccataa agaatggtgt aaaggccctg ggaacctttc ccttatcact gaactacacg      4200
     gaggtatgaa gttcacaagt cctggatcag acacaaagcc tctgactagt caagtcagat      4260
     aatgtctccc atggtagttt ctcctccagg agagagcaga ttcattttct gccgtgttct      4320
     tgggagtaaa ggctaccaag atgaagtgga ctcatagatg atcaaggtag cctgtacaat      4380
     cctttcttgg ggaacacagt agatgcaggt tcattcatac ccagctggta gctaaagagc      4440
     aactccactc ttggcatttg acctgttcag tattactggg tcaaatacat gggccaagct      4500
     ttgtcatagc atgcagggtg ggcatttgga actgacacac gtttatggca cagatacatt      4560
     agtctggggc tgtgtttccc atccaagttc tgcatttccc aggttggctg ctgaggaggg      4620
     gcgtgtagaa tgctgagcct atgcctagct catcaggtag taattgatgt ttaatatttg      4680
     ggtttgttat tgctacttac tgtagctctc aaagcactga gcgacctgtt aattcctgct      4740
     ttgtttcaat ggaaatgatt tgttctgcac tttgggatat cggcggtaga gaccacaggc      4800
     agtgtggtct ctacttgaaa gcttaactgg tatttcttgt atgttttaac agcatgactt      4860
     gttccagggt tgtaatttta aacatcgaga atactgtatt tgcgaaaaaa aaaaaaaaaa      4920
     aaaaaa                                                                 4926
//


spacer
spacer