Dbfetch

ID   BC059776; SV 1; linear; mRNA; STD; MUS; 1069 BP.
XX
AC   BC059776;
XX
DT   10-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus CDP-diacylglycerol synthase (phosphatidate
DE   cytidylyltransferase) 2, mRNA (cDNA clone IMAGE:6484748), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1069
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1069
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2307414e93c5d5bec75f1e5a530278de.
DR   Ensembl-Gn; ENSMUSG00000058793; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026541; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026505; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026479; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026517; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026260; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025721; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026240; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026374; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026338; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026478; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026358; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027017; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025457; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025795; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000110158; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0057847; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0057878; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0057821; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0057816; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057507; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058292; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0057754; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0057479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0057578; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0057555; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0057703; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057525; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058457; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057333; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0056812; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 127 Row: l Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542373
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1069
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="IMAGE:6484748"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1069
FT                   /gene="Cds2"
FT   CDS             100..489
FT                   /codon_start=1
FT                   /gene="Cds2"
FT                   /product="Cds2 protein"
FT                   /db_xref="GOA:Q6PBC0"
FT                   /db_xref="MGI:MGI:1332236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PBC0"
FT                   /protein_id="AAH59776.1"
FT                   /translation="MTELRQRVVREDAPPEDKESESEAKLDGETASDSESRAETAPLPT
FT                   SVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKC
FT                   FHEIITIGYNVYHSYDLPWFRTLSW"
FT   misc_difference 1051..1069
FT                   /gene="Cds2"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1069 BP; 241 A; 264 C; 302 G; 262 T; 0 other;
     gcgaggtgct cgggcccgcc gagagcccgt gctcactgag ccgacccccg cggccaccgt        60
     gctgctcact cggggtgacg tcgcgccggg gtccccagca tgaccgaact acggcagagg       120
     gttgtccgcg aggacgcacc tccggaggac aaggaatcag agtccgaagc aaagctagat       180
     ggagagacag cgtctgacag cgagagccga gcggaaacag ctcccctacc aacctccgta       240
     gatgacaccc cagaggtcct taacagggcc ctttccaacc tgtcctcaag gtggaagaac       300
     tggtgggtga gaggcatcct gactttggcc atgatcgcgt ttttcttcat tatcatttac       360
     ctgggaccaa tggttttgat gatgattgtt atgtgtgtcc agattaagtg tttccatgaa       420
     ataatcacta ttggctacaa tgtataccac tcctacgacc tgccctggtt caggaccctc       480
     agctggtaag ctctctgctc cactggggca ggcaggcacc ttgcctgatt tgagtgatgt       540
     gatttgtggc aggtacttac agtgctggtg gagacattgc cacaggcttg caggagattg       600
     agcctggatt gtatggcacg tttgaggaga cttgagtagc tgaggacttc gtgtcgtctg       660
     tgacagacgt gtcgtctgtg acagatgtgt ctgtgacaga tgtgtctgtg acagatgtgt       720
     ctatggttgg gcttagctca gcagaagggt ccctgagctc ctgcagccag ggactgtatt       780
     gtgcatcgca cccgaggtca gcgtactttt tatgctgcag cccagcgtgt cactggagtc       840
     ctctgggagc tggcaggtcc cggtgccggt gtggctgtct ctggaacttg atttgctcat       900
     cactacagca gactgttgag gttactctct ttaaggcact cggggccggc gtggttcaga       960
     tctgagctcc ttcagagact gctttttttt ttcttctcct aaaaaggatt gtctaacagc      1020
     aaactgctaa ataaagaact gtagcaaaaa aaaaaaaaaa aaaaaaaaa                  1069
//