spacer

EBI Dbfetch

ID   BC059006; SV 1; linear; mRNA; STD; MUS; 4429 BP.
XX
AC   BC059006;
XX
DT   11-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus inositol hexaphosphate kinase 1, mRNA (cDNA clone MGC:69611
DE   IMAGE:6827203), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4429
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4429
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 028edbcdef49b8599b9db2d7e35cd715.
DR   Ensembl-Gn; ENSMUSG00000032594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035214; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 132 Row: n Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254567.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4429
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FY0"
FT                   /clone="MGC:69611 IMAGE:6827203"
FT                   /tissue_type="Brain, mouse, 13.5,14.5,16.5,17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4429
FT                   /gene="Ihpk1"
FT                   /note="synonyms: Itpk6, InsP6"
FT   CDS             301..1602
FT                   /codon_start=1
FT                   /gene="Ihpk1"
FT                   /product="inositol hexaphosphate kinase 1"
FT                   /db_xref="GOA:Q6PD10"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="MGI:MGI:1351633"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PD10"
FT                   /protein_id="AAH59006.1"
FT                   /translation="MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDH
FT                   TVCKPLISREQRFYESLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQ
FT                   DDTPEREQPRRKHSRRSLHRSGSGSDHKEEKASLSFETSESSQEAKSPKVELHSHSDVP
FT                   FQMLDSNSGLSSEKISYNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCV
FT                   LDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYG
FT                   RGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYD
FT                   GKECRSELRLKHVDMGLPEVPPPCGPSTSPSSTSLEAGPSSPPKVDVRMIDFAHSTFKG
FT                   FRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ"
FT   misc_difference 4413..4429
FT                   /gene="Ihpk1"
FT                   /note="polyA tail: 17 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4429 BP; 930 A; 1183 C; 1242 G; 1074 T; 0 other;
     gttgatccgt acccagtggg cagcgccagg agctggaccg agcggccggt gaggggccgc        60
     tgctgcgggg ctcagccacc agcgccgcct gccagggggg cgggccgaga cctggaggcc       120
     cggggggccc agctcccgtg gggagccttg ggcgcccgct gcccgagtcg ggccggacag       180
     aacagtaaac taagcagact gtgaccattg gcctcccact agccaggatc aacttagctc       240
     tccttttgtg gtccatgtgc tgcatcgtct gccatcagtg tgcaaccggc ccccaacgca       300
     atgtgtgttt gtcaaaccat ggaagtgggg cagtatggca agaacgcaag tcgggccgga       360
     gaccgaggag tcctcctgga gcccttcatc catcaggtgg gcgggcacag cagcatgatg       420
     cggtacgacg accacactgt gtgcaaacct ctcatctccc gggaacagcg cttctacgag       480
     tcactccctc ccgaaatgaa ggaattcacc ccagagtaca aaggcgtggt ttctgtctgt       540
     tttgagggag acagtgatgg ttacatcaac ttggtagcct atccttatgt ggagagtgaa       600
     actgtagagc aagatgacac accagagcgg gagcaacctc ggcgcaaaca ctcccgccgg       660
     agcctgcatc ggtctggcag tggtagtgac cacaaggagg agaaagccag cctgtccttt       720
     gagacctctg agagctccca ggaggcaaag agtccaaagg tggaactgca cagccactca       780
     gatgtccctt tccagatgct agacagcaat agcggtctga gctccgagaa gatcagctac       840
     aacccctgga gcctgcgctg ccacaagcag cagctgagcc gcatgcgctc cgagtccaag       900
     gaccgaaaac tctacaagtt cctcctgctt gagaacgtgg tacaccactt caagtacccc       960
     tgtgtgctgg acttgaagat gggtacccgg cagcatggcg atgatgcttc agctgaaaag      1020
     gctgcccggc agatgaggaa gtgtgagcag agcacgtcgg ccacgctggg ggtcagggtc      1080
     tgtggcatgc aggtgtacca gctggacaca ggtcattacc tctgcaggaa taagtactat      1140
     ggccgtggac tctccatcga gggcttccgc aatgcgctct atcagtacct gcacaatggc      1200
     ttggaccttc gacgtgacct ttttgagcca atcctgagca aactgcgggg cctcaaagcc      1260
     gtactggagc ggcaggcctc ctaccgcttc tactccagct ccctgcttgt catctatgat      1320
     ggcaaggagt gccggtctga gctacgtctc aagcacgtgg acatggggct ccctgaggtg      1380
     ccaccaccct gtggccccag caccagtcct agcagcacca gtcttgaggc tggcccctct      1440
     tctccgccca aggtggatgt tcgcatgatt gactttgcac acagcacatt caagggcttc      1500
     cgggatgacc ccactgttca cgatgggcca gacagaggct atgtgtttgg cttggagaat      1560
     cttatcagca tcatggagca gatgcgggat gagaaccagt aggccctgtg ctgggcctag      1620
     gacccccctc ctctccaccc acaggcaggg accattgctc tgaacttgct gtgaggacac      1680
     acagacttgc ttttaaaggg ttatatttct ctttggtgta aactaaaaga aatgttttta      1740
     gctgtagcct ggaatccata tatataaagt agaggagggc agaacatttg tcctctcagc      1800
     caggctcctt agctctgtgg ctgtgactgc tgtgtccagg ctgtctcagg aaggaagagg      1860
     tggccccagt gggcttgaca gcaaagagaa tgaatgcctt gaactttggt ctcccttgcc      1920
     taaggcgttt gggatctgtg gctgtggggc tctgctgatg gtgaggtgaa gccctcggct      1980
     ggcacacggt ctccatgccc aatcatccct tatttcccag aactggggaa ggttaagtgc      2040
     ccacgtcctg agggccatct tagtttcgtg ccagtgctgt aacagatgcc tcagggcatt      2100
     agagggctag ctgcacagac ggactcaccc ttgggtctga ttttggcatg gggctagatc      2160
     ggtgaaactg agctaaggcc aactcagcag agggcaggcc ctgggctccc taggcaccca      2220
     ctggcatgta accctgttcc tctctccaca actcgagcca gcctcttgct gggatccctg      2280
     acctaaggag gcctcatagc ctcctatccc actaagatgg gcacagctgt ttgctgagga      2340
     gagccagtgt cccaggaggc ctaagggcgg gactttagtg gctctggccc agacagtatt      2400
     tgcagttctg ggctctgggt ggcatccctt cctcacctgg ggcagctgtg ctgcttgtgg      2460
     gtgggctgct gctcccaggg ctcaggaacc gtggtccgct cagggtcttg tcttctccag      2520
     gccaagctca aggcagcagc cctgtatgtg gtgctccagg ctctaggcct ggagggagaa      2580
     ctttaaactt gtttgctttt agggacatag ggccctgggc acaggtgccc agcgtctgct      2640
     gagagctttg attaatcctg gggtttgtca gtaagtccat ttgtccacct gctagcccct      2700
     gtctcatggt gagctttctg gagtatagcc ttgttggtta gtatatattg atttccttca      2760
     tgcttccccc agcagtcttc tcctttcctt ttctgaggtg agtctgctcc tgtgcccctc      2820
     ctcagcaggt tctgctgtta caaacctggt ggccaaatga ttcatagtgg tgtttacctg      2880
     ctagcccagt ggccttcttg tgggcctggg gtatggcctt cagcaccaac ggtgggtaat      2940
     gaaggctcag ggttgaccct gacctattgc ttttatttct gctaccagtc ctttcatggt      3000
     agagacctgc tgctgcctgt aacatagtgt ccgacaggtt acactacacc aatcattgcc      3060
     aaggtgagca acagtctcca agtctatcac ttctaacatg tctctgtttt ggcatttgaa      3120
     ggtaatcctg ccaacctttg agagaaactg ttaacgaatg gcataatttc caggttctta      3180
     gagatgcagc ctctgaaaag ggttctgtga cggatccaag tcagtcttct gaccctggtg      3240
     ccattggtgg gcaggttccc attccttagg gccgggaggc acggcttggc ccatctctgc      3300
     ttactaacac ctgtcttctg tccagtagta gtgttgcttg tgccatgcag gcagcaagtg      3360
     ttaattagcg tggacacctt ttctttggca ggatagaggt caagagagga gtttggggcc      3420
     agcagagacc tcctaggaat gtgctgtact tccgatttac cagattttgg gaggtgctgc      3480
     ccccattctg ctgcttctca agtagcaagg gagttggtag gcactgctcc tgccactgca      3540
     agcgaggaaa ggctgggatt tgccgctgct caagggcagg gcctcacttt tcagcacttt      3600
     tgatatctgg aggcccagct ctgttatctg ataggtggtg gcaagtgtgt gcgaacactt      3660
     ttaccactgc tcttctgcct gtcccaggct agagccctgt ctttttcctg acaggtcctg      3720
     ccttcccaat catcaatttg ggaccaaagt gcaactaggg atcatgggtt gggagctcac      3780
     attacccctt tccattgtat ttcccgggcc aagcccatac cagcccgggg agatgggtgg      3840
     gagtgaaatg ggatgggtgc tgctggaaga ggaagggacc agtagagcaa tgtccttgcc      3900
     tgggattcta cccctctcag ctgtgggccg tgcagtggtg tggggattca ttctctccta      3960
     ggggcaaggg acctgggctc ggacagtatc cgttcagtat ccgctgctca ttcgctcaca      4020
     tctggccacg tgcacgttcc ctagatgcaa actgctttga actttacagc tatataagtt      4080
     ggttgtgtgt gtgtgctcat tttaaaaact acattttaac gaggaaaaag gagaacctgg      4140
     ggaaatttcc tttgcttctg tggaggaaat gtaagacttg gaattctgga aattgttatc      4200
     tgctcctctt tcctggaagc tacacaccct aagacctgcg cctggatgca tacgtggctc      4260
     cactggcgct taggcgcgct tgcattttcc ccaggtcttc tgtgtggtgg agaggagtgc      4320
     ttggcccaag ccggcccttt tctgtacacc cagcgctatc cgcccgcttg tgtctggtcg      4380
     tatacgtcaa aataaagcct ctagaaactg aaaaaaaaaa aaaaaaaaa                  4429
//


spacer
spacer