spacer

EBI Dbfetch

ID   BC058785; SV 1; linear; mRNA; STD; MUS; 3152 BP.
XX
AC   BC058785;
XX
DT   10-OCT-2003 (Rel. 77, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus solute carrier family 17 (anion/sugar transporter), member 5,
DE   mRNA (cDNA clone MGC:67681 IMAGE:6309785), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3152
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3152
RA   Strausberg R.;
RT   ;
RL   Submitted (30-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 4a038fdea7efa66c1ea70ebb653f90cd.
DR   Ensembl-Gn; ENSMUSG00000049624; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117645; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119213; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 127 Row: h Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 27370145.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3152
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:67681 IMAGE:6309785"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3152
FT                   /gene="Slc17a5"
FT                   /note="synonyms: 4732491M05, SD, AST, NSD, SLD, ISSD,
FT                   SIASD, SIALIN"
FT   CDS             49..1458
FT                   /codon_start=1
FT                   /gene="Slc17a5"
FT                   /product="Slc17a5 protein"
FT                   /db_xref="GOA:Q8BN82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1924105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BN82"
FT                   /protein_id="AAH58785.1"
FT                   /translation="MRPLLRGPAGNDDEESSDSTPLLPGARQTEAAPVCCSARYNLAIL
FT                   AFCGFFVLYALRVNLSVALVDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTIPGGYIA
FT                   SRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFPAMHAMWSSW
FT                   APPLERSKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVWFILWMWIV
FT                   SDTPETHKTISHYEKEYIVSSLKNQLSSQKVVPWGSILKSLPLWAIVVAHFSYNWSFYT
FT                   LLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFSTISVRRI
FT                   FSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPSYAGIL
FT                   LGITNTFATIPGMTGPIIAKSLTPDNTIREWQTVFCIAAAINVFGAIFFTLFAKGEVQS
FT                   WALSDHHGHRN"
XX
SQ   Sequence 3152 BP; 850 A; 702 C; 722 G; 878 T; 0 other;
     gctaggttgg ccaagcaacg acgccggcac atctgctctc caggcgttat gaggcccctg        60
     cttcggggtc cggcgggaaa cgacgatgag gagagctcgg acagcacccc gctcctgccg       120
     ggcgcccggc agaccgaagc ggctccagtg tgctgctctg ctcggtacaa cttagcgatt       180
     ttggcgttct gtggtttctt cgttctctat gccttacggg tgaacctgag tgttgcgtta       240
     gtggacatgg tagattcaaa tacaactctg actgataata gaacgtctaa ggagtgtgcg       300
     gaacattctg cccccataaa agttcaccac aatcacacaa ttcccggtgg gtacattgcc       360
     agcagggtcg gagggaagct gctgctgggc ctgggcatct taggcacctc cgtcttcacc       420
     ctgttcacac cgctggccgc agacttaggc gtggtgactc tcgttgtgct tagagcgctg       480
     gaaggactgg gagagggtgt tacgtttcca gctatgcacg ccatgtggtc ttcctgggct       540
     ccccctctgg aaagaagcaa gcttcttacc atttcctatg cgggagcaca gcttgggaca       600
     gtgatctcac ttcctctttc cggaataata tgctactata tgaactggac ttacgtcttc       660
     tatctttttg gtatagttgg aattgtctgg tttattttat ggatgtggat agtcagtgat       720
     acaccagaaa ctcacaagac aatctcccat tatgaaaaag aatacattgt ttcatcatta       780
     aaaaatcagc tttcttcgca gaaggtggtg ccgtgggggt ccatcttgaa gtcactgcca       840
     ctttgggcaa ttgtggtagc acatttctcc tacaactggt ctttttacac cttattgacg       900
     ctactgccaa cttatatgaa ggaaatccta aggttcaatg ttcaagagaa cgggttttta       960
     tctgcattgc cttattttgg ctgttggtta tgcatgatcc tctgtggtca agccgctgac      1020
     tatttaaggg tcaagtggaa cttttcaact ataagcgttc ggagaatttt tagcctcgta      1080
     ggaatggttg gccctgcggt tttcctagtc gcggctggat ttataggctg tgactattcc      1140
     ttggccgttg cgttcctaac catatccacg acgctgggag gcttcgcctc ttctggattt      1200
     agcatcaacc atctggatat cgctccttcg tatgctggca tcctcttggg catcacaaac      1260
     acgtttgcca ctattcccgg gatgacggga cccatcattg ctaaaagtct gacccctgat      1320
     aacactatta gggaatggca gactgtcttc tgtatcgctg ctgctattaa cgtgtttggg      1380
     gccattttct tcacgctgtt tgccaaaggg gaagtgcaga gctgggctct cagtgaccac      1440
     cacggacaca gaaactgaag acaacaaaca ataattaatg tgtttttatt tatcatggaa      1500
     actgaaagtg cctttggtat ttgaatgtgc aagcattcta tgtgagagaa aaaaagtact      1560
     tatatttgta tggtaatcat gaaatgttac tagttccaag atcatataaa atgagctgtt      1620
     gggctggaca gatggctcag tggttacgag cactgattgc tcttggagag gtcctgagtt      1680
     caattcccag caaccacatg gtggctcata accatctgta atgggatcag atgccctctt      1740
     ctggtgtgtc tgaagacaga gacagtgtac tcacacacat taaataaata aataaatctt      1800
     taaaaaaaaa gaagaagaag aggctggtcc tcttttaaaa aaataaataa aaaataaaat      1860
     gagctgtttt taattattac tagtatatct gccaggccgt atactgggtt cacatatcag      1920
     gctgcaggaa aggcagtatg atataaggta agggcatagg aaatgaagct gaaatggaca      1980
     cacacacaca cacacacact gataaacttg gttaattaaa tcagataaat catttcagat      2040
     cttattaaaa tacctgcttt tgtctacttc ccttataaaa atgcttgcca actctccctg      2100
     acacctagac ctcaataacg tctccaaaga actgccagcc acagtaagag tcggcagcct      2160
     ggcagcggta ctgggggatc cgtgcccagg cagctgtcaa gcattccctc cctggctgca      2220
     gggcaggaat gcccagcact taccagggat ggtggcttcc aagtgcaggg ccaatgacaa      2280
     gtgtttggct gacactcttt cccccatggc tgttaatgtg cagataaagc tctaagtgga      2340
     ctggagcagt gggagccata gctactgtct tgacactgcc agcctgcctc ggcagcaccc      2400
     gggcccgact cctggcaggt gatctacaaa gcagaagcgt ggtacccagt cagtcacaga      2460
     gaatagcatc cttgattcac atcactggcc catgaattgg agaacacatt ttcacattca      2520
     ggtttttcta gctacattag aactttttta aatgtcttac atttcttccc ttcagtctgt      2580
     cttgatttat gcttctggtt acagtttaaa gggactttca gggccagggg tttggctcag      2640
     tggtagagca tttacatagg attgtgctcc attcaacacc aaaatagagg taaaaggcag      2700
     ggcacccaaa gcttgtcagt cccctttacc ctgcttcctg accagtgtct cccagtggtt      2760
     aggcacactg taagaggtcc ctagtctgtg tggtggtacc tttaatgcca gcacttggga      2820
     ggcagaagca ggcagatctt tgcgacttcg aggccagtct ggtctgcaaa ggggcttcca      2880
     ggacagccgg ggctataact caaaaacaaa aacaaaaaga ttatccaagg attgaaagcc      2940
     tgccttatgt tttgttgtat ctgttcaaca cttatctata acattttaac taatgattgg      3000
     ttaatgtact gttgtgtaaa tacagttata taaatttgtt tttaatttgt aaatataaat      3060
     taagttgcca tgtgacattt cttttataaa tcatcaaaat ccttttgcat taaaaaaaaa      3120
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa                                    3152
//


spacer
spacer