Dbfetch

ID   BC058726; SV 1; linear; mRNA; STD; MUS; 1096 BP.
XX
AC   BC058726;
XX
DT   04-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus cofilin 1, non-muscle, mRNA (cDNA clone MGC:63415
DE   IMAGE:5715707), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1096
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1096
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (24-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 735f3a84d3f45fb69651206e8f47eb69.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542381.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1096
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FB0"
FT                   /clone="MGC:63415 IMAGE:5715707"
FT                   /tissue_type="Mouse, brain 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1096
FT                   /gene="Cfl1"
FT                   /note="synonym: cofilin"
FT   CDS             74..574
FT                   /codon_start=1
FT                   /gene="Cfl1"
FT                   /product="cofilin 1, non-muscle"
FT                   /db_xref="GOA:P18760"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR027234"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="MGI:MGI:101757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18760"
FT                   /protein_id="AAH58726.1"
FT                   /translation="MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
FT                   NIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFW
FT                   APENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEG
FT                   KPL"
FT   misc_difference 1083..1096
FT                   /gene="Cfl1"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1096 BP; 262 A; 313 C; 270 G; 251 T; 0 other;
     tcggatcccg gcagcagctg cggcggctca ggtcttcagt tgctctttct gtctcccttt        60
     cgtttccgga aacatggcct ctggtgtggc tgtctctgat ggtgtcatca aggtgttcaa       120
     tgacatgaag gttcgcaagt cttcaacacc agaagaagtg aagaaacgca agaaggcggt       180
     gctcttttgc ctgagtgagg acaagaagaa catcatcctg gaggagggca aggagatcct       240
     ggtaggagat gtggggcaga ctgtggacga cccctacacc acttttgtca agatgctgcc       300
     agacaaggac tgccgctatg cactctatga tgcaacctat gagaccaagg agagcaagaa       360
     ggaggacctg gtgttcatct tctgggcccc cgagaatgca cccctcaaga gcaaaatgat       420
     ctatgccagc tccaaggatg ccatcaagaa gaagctgaca ggaatcaagc atgaattaca       480
     agctaactgc tacgaggagg tcaaggaccg ctgcaccctg gcagagaaac taggtggcag       540
     cgccgtcatt tccctggagg gcaagccttt gtgagccacc tccagccccc tgcctggagc       600
     atcttaacag ccccagacct gctcttgggt gttgcaggct gcccctttcc tgccagaccg       660
     gaggggctgg ggggatccca gcagggggag ggctatccct tcaccccagt tgccaaacat       720
     ccctcccacc ccctggaccg tccttctccc tccatccctg acggttctgg ccttcccaaa       780
     ctgcttttga tcttctgatt cctcttgggt tgacgcagac caagtcccgt cctaggcacc       840
     cagtttgggg ggagcctgta tttttttttt taacgacacc cctactccgt atccctcccc       900
     atcccatgct gccaacttct aaccacaata gtgactctgt gcttgtctgt ttagttctgt       960
     gtgtaaatga aatgtggaaa tgaccctccc tgccccagct ggctgccctc ccctttcctt      1020
     tgatcttgac cactcatgga agcaggacca gtaagggacc ttcaatttaa aacaaaacaa      1080
     aaaaaaaaaa aaaaaa                                                      1096
//