Dbfetch

ID   BC058710; SV 1; linear; mRNA; STD; MUS; 4643 BP.
XX
AC   BC058710;
XX
DT   27-SEP-2003 (Rel. 77, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus phospholipase C, beta 1, mRNA (cDNA clone MGC:76381
DE   IMAGE:6842016), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4643
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4643
RA   Strausberg R.;
RT   ;
RL   Submitted (22-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; c7e3d3dd97c4befeaf912838853f61e0.
DR   Ensembl-Gn; ENSMUSG00000051177; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026554; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026518; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026492; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026530; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026273; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026975; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025734; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026253; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026387; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026351; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026491; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026371; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027030; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025470; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025808; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000070724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131552; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0057897; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0057928; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0057872; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0057866; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057561; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058343; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0057809; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0057533; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0057632; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0057607; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0057755; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057575; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058507; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057389; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0056862; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. James Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4643
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_GH0"
FT                   /clone="MGC:76381 IMAGE:6842016"
FT                   /tissue_type="Brain"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4643
FT                   /gene="Plcb1"
FT                   /note="synonym: Plcb"
FT   CDS             337..3987
FT                   /codon_start=1
FT                   /product="Plcb1 protein"
FT                   /db_xref="GOA:Q9Z1B3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR009535"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014815"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="InterPro:IPR016280"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR028400"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037862"
FT                   /db_xref="MGI:MGI:97613"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1B3"
FT                   /protein_id="AAH58710.1"
FT                   /translation="MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRT
FT                   DPQGFFFYWTDQNKETELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMIT
FT                   VVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQV
FT                   TPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPR
FT                   PEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
FT                   SSLAKKGQMSVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQL
FT                   AGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECA
FT                   FKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDL
FT                   MYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDD
FT                   DDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGL
FT                   EQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQI
FT                   NMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVG
FT                   TYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEG
FT                   GKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSN
FT                   PIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETSSEAPSETRTTPAENGVNHTASLA
FT                   PKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEM
FT                   KDLVKRHHKKTTELIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSA
FT                   IEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEE
FT                   CQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVV
FT                   QYIKRLEEAQSKRQEKLVEKHNEIRQQILDEKPKLQTELEQEYQDKFKRLPLEILEFVQ
FT                   EAMKGKISEDSNHGSAPPSLASDAAKVNLKSPSSEEIERENPGREFDTPL"
FT   misc_feature    1285..1728
FT                   /note="PI-PLC-X; Region: Phosphatidylinositol-specific
FT                   phospholipase C, X domain. This associates with pfam00387
FT                   to form a single structural unit"
FT   misc_feature    1951..2304
FT                   /note="PI-PLC-Y; Region: Phosphatidylinositol-specific
FT                   phospholipase C, Y domain. This associates with pfam00388
FT                   to form a single structural unit"
FT   misc_feature    2365..2664
FT                   /note="C2; Region: Protein kinase C conserved region 2
FT                   (CalB)"
XX
SQ   Sequence 4643 BP; 1373 A; 1094 C; 1169 G; 1007 T; 0 other;
     ctgaatggtg cgcttccagg cggcggccga gcaggatcca gcggcgggcg actcgcactg        60
     cccggctctg ctcctccgcg tctcccgagg ctctacagtc accgcgggct ccagatcctg       120
     cgtcccgccc ggggcatggc aggctgctgt accctcgcgt gtcgtcccgc ttactaagcg       180
     gcgcgggcca gaggtgcgga ggccaagagg ccggaggccg gcgggcagcg aagcccagag       240
     cctggtgaat cgagagccaa gcccgctcgc gcccggagct ccgcgtcccg tctccactgc       300
     gctcgcccgg gccgcccgga gccccgatga gcccagatgg ctggggctca gcccggagtg       360
     cacgccttgc aactcaagcc cgtgtgcgtg tccgacagcc tcaagaaggg caccaaattc       420
     gtcaagtggg atgatgactc cactattgtt actccaatta ttttgaggac tgatcctcag       480
     ggatttttct tttactggac agaccagaat aaggagacgg agctgttaga tctcagcctt       540
     gtcaaggatg ccaggtgtgg gaagcacgcc aaagctccca aggaccccaa gttgcgtgaa       600
     cttctggatg ttgggaacat cggacacttg gaacagcgca tgataactgt ggtgtatgga       660
     ccagacctgg tgaacatttc ccacttgaat cttgtggctt ttcaagagga agtagccaag       720
     gaatggacaa atgaggtttt cagcttggca acaaacctgc tggctcagaa catgtccagg       780
     gacgcatttc tggagaaagc atatactaag ctcaagctcc aggtcacccc agaaggccgc       840
     attcctctta aaaacatcta tcgattgttc tcagcagacc ggaagcgcgt tgaaactgca       900
     ctagaggctt gtagtcttcc atcttcgagg aatgactcca ttccccaaga ggacttcact       960
     ccagatgtat acagagtttt cctgaacaat ctctgtcccc gacctgaaat tgataacatc      1020
     ttttctgaat ttggtgccaa aagcaaaccg tacctgacgg ttgatcagat gatggatttt      1080
     atcaacctta agcagagaga tccccggctc aatgaaatcc tttacccacc tctgaagcag      1140
     gagcaggtcc aagtgttgat tgagaaatat gagcccaaca gcagcctcgc caagaaaggg      1200
     cagatgtcag tggatggatt catgcgctac ctgagcggag aagaaaatgg agtcgtttca      1260
     cctgagaaac tggatttgaa cgaagacatg tctcagcccc tgtctcacta tttcatcaat      1320
     tcctcgcaca acacctacct cacagctggc cagttggctg ggaactcgtc tgtagagatg      1380
     tatcgccagg tgcttctgtc tggatgtcgc tgtgtggagc tggactgctg gaagggaagg      1440
     accgctgagg aagagcctgt cattacccat ggattcacca tgacaacaga aatatccttc      1500
     aaggaagtca tagaagccat cgcagagtgt gcgttcaaga cgtctccttt ccccatcctc      1560
     ctttcctttg agaaccacgt ggattccccg aagcaacaag ccaagatggc cgagtattgc      1620
     cgattaatct ttggtgatgc cctcctgatg gaaccactgg aaaaataccc actggaatct      1680
     ggggtacctc ttccaagccc tatggattta atgtataaaa tcttggtgaa aaacaagaag      1740
     aagtcgcaca agtcgtcaga gggaagtggt aagaagaagc tttcagagca agcttccaac      1800
     acctacagcg actcctccag tgtgttcgag ccttcgtctc caggagctgg ggaagcagat      1860
     acggagagtg atgacgatga cgacgacgat gactgtaaaa agtcttccat ggatgagggg      1920
     acagctggca gcgaagccat ggccacagaa gagatgtcta acctggtgaa ctatattcag      1980
     cctgtcaagt ttgagtcctt tgaaatttca aaaaaaagaa ataaaagctt tgaaatgtct      2040
     tccttcgtgg aaaccaaagg acttgaacaa cttacaaagt ctccggtgga atttgtagaa      2100
     tacaacaaga tgcaacttag caggatatat cccaagggaa cacgtgtgga ttcatccaac      2160
     tacatgcctc aactcttctg gaatgctggc tgtcagatgg tggcgctcaa cttccagaca      2220
     gtggatctag ctatgcagat aaacatgggc atgtatgagt acaatgggaa gagcggctat      2280
     aggctgaagc cagagttcat gaggaggccg gacaagcatt ttgatccatt tactgaagga      2340
     atcgtagatg ggatagtggc caacactcta tctgttaaga ttatttcagg tcagttcctc      2400
     tctgataaga aagttgggac ttatgtggaa gtggatatgt ttggcttgcc tgtggacaca      2460
     aggaggaagg catttaaaac caagacatcc caaggaaatg ctgtaaaccc tgtctgggaa      2520
     gaagaaccta ttgtattcaa aaaggtagtt ctaccttctc tggcctgttt gaggatagca      2580
     gcatatgaag agggaggcaa atttattggc caccggatat tgcctgtgca ggctattcgg      2640
     ccaggctatc actacatctg cctgcggaat gagaggaacc agcccctgac gctgccagct      2700
     gtctttgtct acatagaagt caaagattat gtgccagaca cgtatgcaga tgtaatcgaa      2760
     gctctatcaa acccaatccg atatgtcaat ctgatggaac agagagctaa gcagctggct      2820
     gcgttgaccc tggaggatga agaggaagta aagaaggagg ctgaccctgg agaaacatct      2880
     tccgaggctc caagcgaaac caggacaacg ccagcagaga atggggtgaa tcacaccgca      2940
     tcccttgcac ccaagccgcc ttcccaggct ccacacagcc agcctgctcc agggtctgtg      3000
     aaggcacctg ccaaaacaga agatctgatc cagagcgtgt taacagaagt agaggcgcaa      3060
     accatcgaag agctcaagca acagaaatcg ttcgtgaaac ttcaaaagaa acactacaaa      3120
     gaaatgaaag acctggtgaa gagacaccac aagaaaacca cggagctcat taaggagcac      3180
     acgaccaagt acaacgagat tcagaatgac tacctgagaa ggagggcagc cttggagaag      3240
     tccgccaaaa aggacagcaa gaagaaatct gaacccagca gccctgacca cggctcatca      3300
     gccattgagc aagacctcgc tgccctggat gcagaaatga ctcagaagtt gatagacttg      3360
     aaagacaagc aacaacagca gctgcttaat cttcggcaag agcagtatta cagcgagaag      3420
     taccaaaagc gagaacacat taaactgctt attcagaagt tgacagatgt tgcagaagag      3480
     tgtcagaaca atcagttaaa gaagctgaag gaaatctgcg agaaagagaa gaaggaatta      3540
     aagaagaaaa tggataagaa gaggcaagag aagataacag aagccaagtc caaagacaaa      3600
     agccagatgg aagaggagaa gacagagatg atccgatcgt acatccagga ggtggttcag      3660
     tacatcaaga ggttagagga agcacaaagt aaaagacaag aaaaactcgt ggagaaacac      3720
     aatgagatcc gccagcagat cctcgatgag aagcccaagc tgcagacgga gctggagcaa      3780
     gaataccaag acaagttcaa aaggctgccc ctggagattc tggagtttgt acaggaagcc      3840
     atgaaaggga agatcagcga ggacagcaat cacggctctg cccctccctc tctggcctca      3900
     gatgctgcaa aggtgaacct caagtctccc tccagtgagg agatagaaag agagaaccca      3960
     ggaagagagt ttgatactcc tctgtgatgc ccctgtcagg ccttccagac atgcacagct      4020
     gcttgagctc cagtggactc taatgacaaa tatcactgcc tgggccatct tcctgagaaa      4080
     tatcccttag cctgaaatcc acaccaaagg gagacttcca gaaggatccg tgtgaaggtc      4140
     ccataccctg gttccatgtg tcatgtggaa actattgcca gtcttagaca gaagggtgca      4200
     tgtatgcagg atttttcttt ttgtcccaat agtaaattaa gagcaggcag ctcccaggct      4260
     ccatggaata tgtaatgaag gacaatgtct tcttggacga aaatgagagc tcctgtcttc      4320
     atttgaagct ctggtgtaca gtatttcaaa gtaaaagaaa tagtttgaga agtgcgcagc      4380
     tccatttaac actatggaac attccacttt gagcattgtt ttcctaactg ccccgcaatt      4440
     ccatgttttc aagttaacgt gtatagtgaa ttgtgtcatc ctttgctttg caggcactgg      4500
     tggcttgccg tttgctaatt tatttatcac agaggcatct gtatttgcta ttgacatggc      4560
     tttattagat accatagtga ctcatataag ctggtttctt ttataaaata aaaaaaaatc      4620
     acatgaaaaa aaaaaaaaaa aaa                                              4643
//