spacer

EBI Dbfetch

ID   BC058230; SV 1; linear; mRNA; STD; MUS; 4200 BP.
XX
AC   BC058230;
XX
DT   19-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus AXL receptor tyrosine kinase, mRNA (cDNA clone MGC:65282
DE   IMAGE:6313662), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4200
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4200
RA   Strausberg R.;
RT   ;
RL   Submitted (15-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 83fbb4c1b4f55bdb596b90645822c45d.
DR   Ensembl-Gn; ENSMUSG00000002602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085948; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 127 Row: i Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6680759.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4200
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:65282 IMAGE:6313662"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4200
FT                   /gene="Axl"
FT                   /note="synonyms: Ark, Tyro7"
FT   CDS             144..2783
FT                   /codon_start=1
FT                   /product="Axl protein"
FT                   /db_xref="GOA:Q6PE80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:1347244"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PE80"
FT                   /protein_id="AAH58230.1"
FT                   /translation="MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLT
FT                   GTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLS
FT                   DAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPV
FT                   TLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRP
FT                   HHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQV
FT                   SVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNG
FT                   SQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVS
FT                   VTAYTSAGDGPWSLPVPLEPWRPVSEPPPRAFSWPWWYVLLGALVAAACVLILALFLVH
FT                   RRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVD
FT                   RHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKE
FT                   FDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQPVFLPTQMLV
FT                   KFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIA
FT                   KMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRL
FT                   KQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDEILYVNMDEG
FT                   GSHLEPRGAAGGADPPTQPDPKDSCSCLTAADVHSAGRYVLCPSTAPGPTLSADRGCPA
FT                   PPGQEDGA"
FT   misc_feature    246..485
FT                   /note="IG; Region: Immunoglobulin"
FT   misc_feature    558..797
FT                   /note="IG; Region: Immunoglobulin"
FT   misc_feature    807..1088
FT                   /note="fn3; Region: Fibronectin type III domain"
FT   misc_feature    1134..1379
FT                   /note="fn3; Region: Fibronectin type III domain"
FT   misc_feature    1704..2507
FT                   /note="TyrKc; Region: Tyrosine kinase, catalytic domain"
XX
SQ   Sequence 4200 BP; 970 A; 1140 C; 1103 G; 987 T; 0 other;
     ggaggagttg agccagccga ggggctcccg ctgtgccagg cgggcagtgc caaatcccag        60
     gagccctgcc ccctttccta gcgaggtgcc catcaacttc ggaagaaagt ttggcatcaa       120
     tctgagctgt tggtgtctgg aggatgggca gggtcccgct ggcctggtgg ttggcgctgt       180
     gctgctgggg gtgtgcagcc cataaggaca cacagaccga ggctggcagc ccgtttgtgg       240
     ggaacccagg gaatatcaca ggtgccagag gactcacggg gacacttcgg tgtgagctcc       300
     aggttcaggg ggaaccccct gaggtggtgt ggcttcgaga tggacagatc ctagaactgg       360
     ctgataacac ccagacccag gtgcctctgg gcgaagactg gcaagatgaa tggaaagttg       420
     tcagtcagct cagaatctca gccctgcaac tttcagatgc aggggagtac cagtgtatgg       480
     tgcatctaga aggacggacc tttgtgtctc agccgggctt tgtagggctg gaaggtctcc       540
     cgtacttcct ggaggagcct gaggacaaag ctgtgcctgc caacacccct ttcaacctaa       600
     gctgccaggc ccagggaccc ccggaacccg tgaccctact ctggcttcaa gatgctgtcc       660
     ccctggcccc agtcacagga cacagctccc agcacagtct gcaaactcca ggcctgaaca       720
     agacatcttc tttctcatgt gaagcccaca atgccaaggg agtcaccacc tcccgcacag       780
     ccaccatcac agtgctcccc cagaggcctc accatctcca cgtggtttcc agacaaccta       840
     cggagctaga ggtagcttgg acccctggcc tgagtggcat ctacccgctc acccactgca       900
     acctgcaggc cgtgctgtca gacgatgggg tgggtatctg gctgggaaag tcagatcctc       960
     ctgaagaccc cctcaccttg caagtatcag tgccccccca ccagcttcgg ctggaaaagc      1020
     tccttcctca caccccgtat cacatccgga tatcctgcag cagcagccag ggcccctcac      1080
     cttggaccca ctggcttcct gtggagacca cagagggagt gcccttgggt ccccctgaga      1140
     acgttagcgc catgcggaat gggagccagg tcctcgtgcg ttggcaggag ccaagggtgc      1200
     ccctgcaagg caccctgtta gggtaccggc tggcatatcg aggccaggac acccccgagg      1260
     tacttatgga tatagggcta actcgagagg tgaccttgga actgcggggg gacaggcctg      1320
     tggctaacct gactgtgtct gtgacagcct atacctcggc tggggatggg ccctggagcc      1380
     ttcctgtgcc cctagagccc tggcgcccag tgagtgaacc cccacctcgc gccttctcgt      1440
     ggccttggtg gtatgtactg ctgggagcac ttgtggctgc cgcctgcgtc ctcatcttgg      1500
     ccctgttcct tgtccatcgg aggaagaagg agactcgata tggggaggtg tttgagccaa      1560
     ccgtggaaag aggtgaactg gtagtcaggt accgtgtccg aaagtcctac agccggcgga      1620
     ccactgaagc caccttgaac agtctgggca tcagtgaaga gctgaaggag aaactacgag      1680
     acgtcatggt agatcggcat aaggtggcct tggggaagac cctgggagaa ggagaatttg      1740
     gcgctgtgat ggaaggtcag ctcaatcagg atgactccat cctcaaggtc gctgtgaaga      1800
     ccatgaaaat tgccatctgc acaagatcag agctggagga tttcctgagt gaagctgtct      1860
     gcatgaagga atttgaccac cccaacgtca tgaggctcat tggcgtctgt tttcagggct      1920
     ctgacagaga gggtttccca gaacctgtgg tcatcttgcc tttcatgaaa cacggagacc      1980
     tacacagttt cctcctgtac tcccggctcg gggaccagcc agtgttcctg cccactcaga      2040
     tgctagtgaa gttcatggcc gacattgcca gtggtatgga gtacctgagt accaagagat      2100
     tcatacatcg ggacctggct gccaggaact gcatgctgaa tgagaacatg tccgtgtgtg      2160
     tggcagactt cgggctctcc aagaagatct acaacgggga ttactaccgc caagggcgca      2220
     ttgccaagat gccagtcaag tggattgcta ttgagagtct ggcagatcgg gtctacacca      2280
     gcaagagcga tgtgtggtcc ttcggtgtga caatgtggga gatcgccacc cgaggccaaa      2340
     ctccctatcc aggggtggag aacagtgaga tttacgacta cctgcgtcaa ggaaatcggc      2400
     tgaaacagcc tgtggactgt ctggacggcc tgtatgccct gatgtctcgg tgctgggaac      2460
     tgaaccctcg agaccggcca agttttgcgg agctccggga agacttggag aacacactga      2520
     aggctctgcc ccctgctcag gagccagatg aaatcctcta tgtcaacatg gatgagggcg      2580
     gaagccacct tgaaccccgt ggggctgctg gaggagctga ccccccaacc caacctgatc      2640
     ctaaggattc ctgtagctgt ctcactgcag ctgacgtcca ctcagctgga cgctatgtcc      2700
     tttgtccttc tacagcccca ggacccactc tgtctgctga cagaggctgc ccagcacctc      2760
     cagggcagga ggacggagcc tgagacaatc ttccacctgg gacatcctct caggacccaa      2820
     gctaggcact gccactgggg gaaagctcac ccccccactc cgtcactcca ggccttctcc      2880
     ccagatgcag aatggccttc cctcccttct cagatgcagt ccatgcctta tgcaccctat      2940
     ccataacagt ttcaagggat cgtctcacat cttccatccc agcgttctag attttaaggt      3000
     ttgagtttag agttcaaagt tctcaaagat gatgagtctt tggaccgaga tgcttgtttc      3060
     taggtctgca gcgctgttgc tatagacagg cccactgctc gaaggctctg agattctatg      3120
     gctctagatt tttctggctc tataattcgt ggcaatgctc ccatggtttt aggttgcacg      3180
     actctgagat tccaggacct aaggcttcta gactttattt ttctggagcc aggggtcctg      3240
     tcagtggaag attgtagatt tttaaattct aaagattcta ggcatgaagg ttctaaggca      3300
     tactgcttct ccagtttaac agtttagggc tcatgttgga atactccaga tcataatgtt      3360
     tcaaactttt atttttttta atttctaaga ccccagtgat ggtcaactac agattctgaa      3420
     gccttatgac catagattct tttatataaa aatcctgtat ctcaaggaaa tatgattcta      3480
     gactctgaaa ttccaaagct ttaagagtct ccagatggag tttctaagct atgatgtggt      3540
     gataatctaa agtttagtcc aaggttctag attcctaagc ttccacgtca tctgctccca      3600
     ggattccaga ttattaaact ctaaaactct aatgttggcc tgatcttcgt ctcaggccct      3660
     gtaggatgct gtgggtcctc agcatctaag tcacaagagg ctccagttaa cgaggactaa      3720
     tgagacacca aagttctaac cacttctaat gctggacacc tctaggttct atgctgcttt      3780
     ttgcctttct agcacataat taaatgccca agaatacata tgtctaaaga tcttaaatct      3840
     ctaagcacta tggagccaat gttttgagtg tctgagattc taaaggtcca cagtctagag      3900
     tattaggtac gactccaagg gtgggcgctt gtagccatcc taagtccttt ccctccttaa      3960
     gcacctatgc tcctcctctc cttgtgtggg gtacacccca ccttaagcct gtgcgatgca      4020
     ctgggaatgc ctgctttcct ccaagggatg ggtcatctcc cctcatttgg ggccatgttg      4080
     ccccttgagc cagtccccta tgcctgttct gaagtgtgga ctctggtgcc tccagagagg      4140
     ctcagatcac ataaaacttt tgtcagtcac taaaaaaaaa aaaaaaaaaa aaaaaaaaaa      4200
//


spacer
spacer