spacer

EBI Dbfetch

ID   BC057956; SV 1; linear; mRNA; STD; MUS; 2935 BP.
XX
AC   BC057956;
XX
DT   01-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus sema domain, immunoglobulin domain (Ig), short basic domain,
DE   secreted, (semaphorin) 3E, mRNA (cDNA clone MGC:68023 IMAGE:5357516),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2935
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2935
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5a6fd91adb2be320015e2bb986e5ce91.
DR   Ensembl-Gn; ENSMUSG00000063531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073957; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 123 Row: p Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 7549788.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2935
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:68023 IMAGE:5357516"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2935
FT                   /gene="Sema3e"
FT                   /note="synonym: mKIAA0331"
FT   CDS             533..2860
FT                   /codon_start=1
FT                   /gene="Sema3e"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3E"
FT                   /db_xref="GOA:P70275"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70275"
FT                   /protein_id="AAH57956.1"
FT                   /translation="MAPAGHILTLLLWGHLLELWTPGHSANPSYPRLRLSHKELLELNR
FT                   TSIFQSPLGFLDLHTMLLDEYQERLFVGGRDLVYSLNLERVSDGYREIYWPSTAVKVEE
FT                   CIMKGKDANECANYIRVLHHYNRTHLLTCATGAFDPHCAFIRVGHHSEEPLFHLESHRS
FT                   ERGRGRCPFDPNSSFVSTLVGNELFAGLYSDYWGRDSAIFRSMGKLGHIRTEHDDERLL
FT                   KEPKFVGSYMIPDNEDRDDNKMYFFFTEKALEAENNAHTIYTRVGRLCVNDMGGQRILV
FT                   NKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHA
FT                   VCVYHMSSIREAFNGPYAHKEGPEYHWSLYEGKVPYPRPGSCASKVNGGKYGTTKDYPD
FT                   DAIRFARMHPLMYQPIKPVHKKPILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTG
FT                   IVLKVITIYNQETEWMEEVILEELQIFKDPAPIISMEISSKRQQLYIGSASAVAQVRFH
FT                   HCDMYGSACADCCLARDPYCAWDGISCSRYYPTGAHAKRRFRRQDVRHGNAAQQCFGQQ
FT                   FVGDALDRTEERLAYGIESNSTLLECTPRSLQAKVIWFVQKGRDVRKEEVKTDDRVVKM
FT                   DLGLLFLRVRKSDAGTYFCQTVEHNFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHKM
FT                   PCPPLSGMSQGTKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYAN
FT                   PQEKRLRSKAEHFRLPRHTLLS"
FT   misc_difference 2918..2935
FT                   /gene="Sema3e"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2935 BP; 802 A; 703 C; 782 G; 648 T; 0 other;
     ggcggcatcc ccgctgggtg gatcccgcgc tcctggcgca agtggcactt cttgcttcta        60
     attatcgaga ggagaggcga atacgaacta gctgctcggc aagtcagtgc aggaggctga       120
     cttctgggag gctggcgggg aggctggggg aagagctggg ggaggctgct gctctgctcc       180
     gactgttttc tcaatgaata gctggcgggg agactgaagc tagccacagc ctcctcctca       240
     ctccgcgtct gggtgacggc gacagcacca gcccggacct ggctctcaag acgcgctcct       300
     tggacggtct cttgctccgc gcttctaacc accgggccca aggacagaaa ggcttagcgg       360
     atccaaatat tgcccggcaa atggcacttg ggaatggtat tttctgatga caaccccttc       420
     tgtttgtgac aaagcctgtc gcccgcagtt gcccctggag ggaagtacta agtaaaactc       480
     aatcctgtct taaagtgtgg ctgcaggggc cagaggagag ccagcacgca ccatggcacc       540
     ggccggacac atcctcacct tgctgctctg gggtcacctg ctggaactct ggaccccagg       600
     tcactccgcg aacccctcct accccaggct acgcctgtca cataaagaac ttttggaact       660
     gaataggact tcaatatttc aaagccccct tggatttctt gatctccata caatgctgct       720
     ggatgagtat caagaacggc tctttgtggg aggcagagac cttgtctatt ccctgaactt       780
     ggaacgagtc agtgacggct acagagagat atactggccg agcacagcag taaaggtaga       840
     agaatgcata atgaaaggaa aagacgcaaa tgagtgtgcc aattatatcc gggttttgca       900
     tcactacaac aggacacacc ttctgacctg tgctactgga gcttttgatc cacactgtgc       960
     cttcatcaga gtcgggcacc attcagagga acccctgttt cacctggagt cacacagatc      1020
     tgagagagga aggggcagat gtccttttga ccccaactcc tcctttgtgt ccacgctagt      1080
     tgggaatgag ctgtttgctg gactctacag tgactattgg ggcagagact cggcgatctt      1140
     ccgcagcatg gggaagttag gccatattcg cactgagcat gacgatgagc ggctcctgaa      1200
     agaaccaaaa tttgtaggtt catatatgat tcctgataac gaagaccgag atgacaacaa      1260
     aatgtacttt ttctttactg agaaggcgct ggaggcggag aacaacgccc acacgatcta      1320
     cacccgagtg gggcggctgt gcgtgaatga catgggagga cagagaatcc tggtgaacaa      1380
     gtggagcact ttccttaaag cgcggctggt ttgctcagtg ccgggaatga atggaatcga      1440
     cacatacttt gacgaactag aggatgtgtt tttactgccg accagagatc ctaagaatcc      1500
     agtgatattt ggactgttta atactaccag caatatattt agaggccatg ctgtatgtgt      1560
     gtatcacatg tcaagtatcc gggaagcctt taatggccca tatgctcata aagaaggccc      1620
     tgaataccac tggtcactat atgaaggaaa agtcccctac ccaaggcctg gttcctgtgc      1680
     cagcaaagta aacggaggca agtatggaac caccaaagat taccccgatg acgccatccg      1740
     gttcgcaagg atgcatcctc taatgtatca gcccataaaa cctgttcata aaaaaccaat      1800
     actggtaaaa acagatggaa aatacaacct gaggcaactt gccgtggatc gggtggaagc      1860
     ggaggatggc cagtatgacg tcttatttat tgggacagac acaggaattg tgctgaaagt      1920
     aatcacaatt tacaaccaag aaacagagtg gatggaggaa gtcattctag aggaacttca      1980
     aatattcaag gatccagccc ctatcatttc tatggaaatt tcttcaaaga gacaacagct      2040
     ttacattgga tcagcctctg ctgtggcaca agtcagattc catcactgcg acatgtatgg      2100
     cagtgcttgt gctgactgct gcctggctcg agacccgtac tgtgcctggg atggcatatc      2160
     ctgctccagg tactacccaa caggtgcaca cgcaaagagg aggttccgca ggcaggacgt      2220
     tcggcatggc aacgccgccc aacagtgctt tggacagcaa tttgttggag acgcgttgga      2280
     caggactgaa gagaggctgg cttatggcat agagagcaac agtactctgt tggaatgcac      2340
     cccgcgatca ctacaagcaa aagtcatctg gtttgtacag aagggacgcg acgtaagaaa      2400
     agaagaggtg aagacggatg acagagttgt caagatggac ttgggcttgc tcttcctcag      2460
     agtacgcaag tcagatgcag ggacctattt ttgccagaca gtagaacaca attttgtcca      2520
     tactgtgcgt aaaatcacct tggaggtggt cgaagagcat aaagtggagg gcatgtttca      2580
     taaggaccat gaagaggaaa gacatcacaa gatgccctgc cctcccttaa gcggtatgtc      2640
     tcaggggaca aaaccgtggt acaaggaatt cttgcagctg attggctaca gcaacttcca      2700
     gagagtggaa gaatactgcg aaaaggtgtg gtgtacagat aagaagagga aaaagcttaa      2760
     aatgtctccc tccaagtgga agtatgccaa cccccaggaa aagaggcttc gctctaaagc      2820
     tgagcacttc cgcctgccca ggcacacgct gctctcctga gggcgccctc tgccggcggc      2880
     tgaggaacct aggatggaaa cattttttta aagggggtta aaaaaaaaaa aaaaa           2935
//


spacer
spacer