Dbfetch

ID   BC057926; SV 1; linear; mRNA; STD; MUS; 2490 BP.
XX
AC   BC057926;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus matrix metallopeptidase 16, mRNA (cDNA clone MGC:68000
DE   IMAGE:5292478), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2490
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2490
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c72ac0541fa63d679082d2cc9d37f046.
DR   Ensembl-Gn; ENSMUSG00000028226; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028077; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028035; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028046; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027776; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028489; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027231; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027749; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027892; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027858; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028001; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027891; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028548; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026951; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027308; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000029881; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064794; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0064824; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0064764; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064743; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064434; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065235; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064765; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0064384; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0064505; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0064456; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0064641; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064457; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065451; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064287; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063685; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Chu-Xia Deng Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 123 Row: j Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254543.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2490
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="129,C57BL/6J,FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam3"
FT                   /clone="MGC:68000 IMAGE:5292478"
FT                   /tissue_type="Mammary tumor. Brca1-/fl; MMTV-Cre model. 10
FT                   months old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2490
FT                   /gene="Mmp16"
FT                   /note="synonyms: Mt3mmp, MT3-MMP"
FT   misc_difference 154..155
FT                   /gene="Mmp16"
FT                   /note="2 bases in cDNA are not found in the mouse genome."
FT   CDS             242..2065
FT                   /codon_start=1
FT                   /gene="Mmp16"
FT                   /product="matrix metallopeptidase 16"
FT                   /db_xref="GOA:Q9WTR0"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR021805"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028697"
FT                   /db_xref="InterPro:IPR033739"
FT                   /db_xref="MGI:MGI:1276107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTR0"
FT                   /protein_id="AAH57926.1"
FT                   /translation="MILLAFSSGRRLDFVHRSGVFFLQTLLWILCATVCGTEQYFNVEV
FT                   WLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVP
FT                   DQTRGSSKFNIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVT
FT                   PLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF
FT                   DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND
FT                   DLQGIQKIYGPPDKIPPPTRPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKP
FT                   NICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS
FT                   DGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDR
FT                   YWRYSEEMKTMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKV
FT                   EPGYPRSILKDFMGCDGPTDRDKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALC
FT                   LLVLVYTVFQFKRKGTPRHILYCKRSMQEWV"
FT   misc_difference 2477..2490
FT                   /gene="Mmp16"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2490 BP; 696 A; 577 C; 574 G; 643 T; 0 other;
     ggccgggtga ggatggtgaa cacttgccgc cgctgaccct gcctttcctc tgtttctccc        60
     cggctgccga gcctggcgcc catccccatc cctggacggg tgggtgaacc tgcaagcttt       120
     tacccacccc aggactggat tttttttttt tttttctttt taaaaggaaa cagggagtgg       180
     acattcggaa agagggagaa aacgcagggg agctcgtcca tccgttgagg cacagttcac       240
     tatgatctta ctcgcattca gctctggaag aaggttggat ttcgtgcatc gttcgggtgt       300
     gtttttcttg caaaccttgc tttggatttt atgtgctaca gtctgcggaa cggagcagta       360
     tttcaatgtg gaggtttggt tacaaaaata cggctacctt ccaccgactg accccagaat       420
     gtcagtgctg cgctctgcag agaccatgca gtcagctcta gctgccatgc agcagttcta       480
     tggcattaac atgacaggaa aagtggacag aaacacaatc gactggatga agaagcctcg       540
     atgcggtgta ccagaccaga caagaggcag ctctaaattc aacattcgtc gaaagcgcta       600
     cgcattaact ggacagaaat ggcaacacaa acatatcact tacagtataa agaacgtaac       660
     tccaaaagtt ggagatcctg agacccggag agcaattcgc cgtgcctttg atgtgtggca       720
     gaatgtaact cctctaacgt ttgaagaagt tccctacagt gaactagaaa acggcaaacg       780
     tgatgtggat ataaccatca tttttgcttc tggttttcat ggagacagtt ccccatttga       840
     tggggaggga ggatttttgg cacatgctta tttccctgga cccggaattg gaggcgacac       900
     ccattttgat tctgatgagc catggacact gggaaatccc aatcatgatg gaaacgattt       960
     atttcttgta gcagtccatg agctgggaca tgctctagga ctggaacatt ccaacgaccc      1020
     caccgctatc atggccccat tttatcagta catggaaaca gacaacttca agcttcctaa      1080
     tgatgattta cagggcatcc agaagatata tggtccacct gacaagatcc ctccacctac      1140
     aagacctcta ccgacagtgc ccccgcaccg atctgttcct ccagcagacc caaggagaca      1200
     tgacaggccc aaacctcctc ggcctcccac tggcagaccc tcctatccag gagccaaacc      1260
     caacatctgt gatgggaact tcaacactct agctattctt cgaagggaga tgtttgtttt      1320
     caaggaccag tggttttggc gagtgagaaa caacagggtg atggatggat acccaatgca      1380
     aattacttac ttctggcggg gccttcctcc cagtattgat gcagtttatg aaaacagtga      1440
     cggaaatttc gtcttcttta aaggcaacaa atactgggtg ttcaaagaca caactcttca      1500
     acctggttac cctcatgact tgattaccct tgggaatgga atcccccctc atggtattga      1560
     ttctgccata tggtgggaag atgttggcaa aacctatttc ttcaaaggtg acaggtattg      1620
     gagatatagt gaagaaatga aaaccatgga ccctggttac cccaagccca tcaccatctg      1680
     gaaggggatc cctgaatcac ctcagggagc tttcgtccac aaagaaaatg gctttaccta      1740
     tttctacaaa ggaaaggagt attggaaatt caacaatcag atactcaaag tagaacctgg      1800
     ttatccaaga tccatcctca aggactttat gggctgtgat ggaccaacag accgagataa      1860
     agaaggactc agcccaccag atgatgtaga cattgtcatc aaactggaca acacagccag      1920
     cactgtgaaa gccatagcta ttgtcattcc ctgcatcttg gccttatgcc tccttgtatt      1980
     ggtttacact gtgttccagt tcaagaggaa aggaacaccc cgccacatac tgtactgtaa      2040
     acgctctatg caagagtggg tgtgatgtag ggatttcttt tttctttctt ttctgggagt      2100
     ttgtggtaac ttgagattca agacaagagc tgttatgctg tttcctagct aggagcaggc      2160
     ttgtggcagc ctgatggagg ctgaccttcc aaacctagat ggttgctggt cctgcacatg      2220
     agtggaaata taatcatgga gaagcttccg tgatgcacag tatctgctgt tctccagtcc      2280
     tctgtctttc tttgtcattc agttctaggc ctttcctctg cacgctcaat gcccagtaaa      2340
     atttcaggat taactgaaga agaggaaata tagaagaaaa gtttcttctt aattttttaa      2400
     aaaatacatt tccttctgaa atctgagccc atttctggga aagagaaaga aagagagaga      2460
     aagagagaga gagagaaaaa aaaaaaaaaa                                       2490
//